Property Summary

NCBI Gene PubMed Count 88
Grant Count 157
R01 Count 115
Funding $15,396,144.8
PubMed Score 403.85
PubTator Score 250.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma -1.487 0.031
glioblastoma 2.200 0.000
group 3 medulloblastoma 2.500 0.000
atypical teratoid / rhabdoid tumor 2.000 0.000
medulloblastoma, large-cell 3.100 0.000
primitive neuroectodermal tumor 2.100 0.000
non-small cell lung cancer 2.099 0.000
lung cancer 3.500 0.000
colon cancer 1.800 0.001
lung adenocarcinoma 1.800 0.000
pediatric high grade glioma 1.600 0.000
Breast cancer 1.300 0.000
ductal carcinoma in situ 1.300 0.007
invasive ductal carcinoma 1.900 0.001
ovarian cancer 1.300 0.000
psoriasis 1.600 0.000

Synonym

Accession Q9UQ84 O60545 O75214 O75466 Q5T396 Q96IJ1 Q9UG38 Q9UNW0 hExo1
Symbols HEX1
hExoI

Gene

PDB

3QE9   3QEA   3QEB  

 GWAS Trait (1)

Gene RIF (74)

PMID Text
27098497 CRL4(Wdr70) regulates H2B monoubiquitination and facilitates Exo1-dependent DNA repair resection.
26221031 EXO1 and FEN1 cleaved the substrate at the boundary between the single-stranded 5' flap and the duplex, whereas FAN1 incised it three to four nucleotides in the double-stranded region.
26215063 MSH2, MSH6, and EXO1 genes were overexpressed in gastroesophageal cancers.
25833945 14-3-3 proteins restrain the Exo1 nuclease to prevent over-resection in end joining
25598504 Our data present, for the first time, evidence that inherited MLH1 c.-93G>A, MSH2 c.211 + 9C>G, MSH3 c.3133G>A, and EXO1 c.1765G>A abnormalities of DNA MMR pathway are important determinants of head and neck squamous cell carcinoma
24829445 This study reports that, contrary to earlier reports, and unlike the catalytic site mutant D173A, the EXO1 E109K variant resembled the wild-type enzyme on all tested substrates.
24824601 FOXM1 is upregulated in chemoresistant ovarian cancer samples, and defends ovarian cancer cells against cytotoxicity of cisplatin. FOXM1 facilitates DNA repair through regulating EXO1 to protect ovarian cancer cells from cisplatin-mediated apoptosis.
24761866 EXO1 Glu589Lys polymorphism is not associated with overall cancer susceptibility.
24705021 In summary, phosphorylation of EXO1 by CDKs is a novel mechanism regulating repair pathway choice.
24204293 These studies establish that the Mlh1-Pms1 endonuclease is required for MMR in a previously uncharacterized Exo1-independent MMR pathway.
More...

AA Sequence

MGIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCMKFVNMLLSHG      1 - 70
IKPILVFDGCTLPSKKEVERSRRERRQANLLKGKQLLREGKVSEARECFTRSINITHAMAHKVIKAARSQ     71 - 140
GVDCLVAPYEADAQLAYLNKAGIVQAIITEDSDLLAFGCKKVILKMDQFGNGLEIDQARLGMCRQLGDVF    141 - 210
TEEKFRYMCILSGCDYLSSLRGIGLAKACKVLRLANNPDIVKVIKKIGHYLKMNITVPEDYINGFIRANN    211 - 280
TFLYQLVFDPIKRKLIPLNAYEDDVDPETLSYAGQYVDDSIALQIALGNKDINTFEQIDDYNPDTAMPAH    281 - 350
SRSHSWDDKTCQKSANVSSIWHRNYSPRPESGTVSDAPQLKENPSTVGVERVISTKGLNLPRKSSIVKRP    351 - 420
RSAELSEDDLLSQYSLSFTKKTKKNSSEGNKSLSFSEVFVPDLVNGPTNKKSVSTPPRTRNKFATFLQRK    421 - 490
NEESGAVVVPGTRSRFFCSSDSTDCVSNKVSIQPLDETAVTDKENNLHESEYGDQEGKRLVDTDVARNSS    491 - 560
DDIPNNHIPGDHIPDKATVFTDEESYSFESSKFTRTISPPTLGTLRSCFSWSGGLGDFSRTPSPSPSTAL    561 - 630
QQFRRKSDSPTSLPENNMSDVSQLKSEESSDDESHPLREEACSSQSQESGEFSLQSSNASKLSQCSSKDS    631 - 700
DSEESDCNIKLLDSQSDQTSKLRLSHFSKKDTPLRNKVPGLYKSSSADSLSTTKIKPLGPARASGLSKKP    701 - 770
ASIQKRKHHNAENKPGLQIKLNELWKNFGFKKDSEKLPPCKKPLSPVRDNIQLTPEAEEDIFNKPECGRV    771 - 840
QRAIFQ                                                                    841 - 846
//

Text Mined References (95)

PMID Year Title
27098497 2016 CRL4(Wdr70) regulates H2B monoubiquitination and facilitates Exo1-dependent resection.
26221031 2015 FANCD2-associated nuclease 1, but not exonuclease 1 or flap endonuclease 1, is able to unhook DNA interstrand cross-links in vitro.
26215063 2015 Mismatch repair gene expression in gastroesophageal cancers.
25833945 2015 14-3-3 proteins restrain the Exo1 nuclease to prevent overresection.
25598504 2015 Association between genetic polymorphisms in DNA mismatch repair-related genes with risk and prognosis of head and neck squamous cell carcinoma.
24829445 2014 Biochemical characterization of a cancer-associated E109K missense variant of human exonuclease 1.
24824601 2014 FOXM1 modulates cisplatin sensitivity by regulating EXO1 in ovarian cancer.
24761866 2014 The exonuclease 1 Glu589Lys gene polymorphism and cancer susceptibility: evidence based on a meta-analysis.
24705021 2014 Phosphorylation of EXO1 by CDKs 1 and 2 regulates DNA end resection and repair pathway choice.
24204293 2013 Dominant mutations in S. cerevisiae PMS1 identify the Mlh1-Pms1 endonuclease active site and an exonuclease 1-independent mismatch repair pathway.
More...