Property Summary

NCBI Gene PubMed Count 100
PubMed Score 436.97
PubTator Score 250.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 1.200 2.3e-03
atypical teratoid / rhabdoid tumor 2.000 1.4e-09
Breast cancer 1.300 1.4e-10
colon cancer 1.800 6.6e-04
ductal carcinoma in situ 1.300 6.9e-03
glioblastoma 1.600 3.1e-05
group 3 medulloblastoma 2.500 1.6e-05
invasive ductal carcinoma 1.900 1.1e-03
lung adenocarcinoma 1.300 2.5e-10
lung cancer 2.400 1.6e-04
malignant mesothelioma 1.300 5.3e-07
medulloblastoma, large-cell 3.100 4.7e-07
non-small cell lung cancer 2.099 4.9e-25
osteosarcoma -1.487 3.1e-02
ovarian cancer 1.300 8.2e-11
primitive neuroectodermal tumor 2.100 1.9e-04
psoriasis 1.600 2.3e-91

Gene RIF (82)

AA Sequence

MGIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCMKFVNMLLSHG      1 - 70
IKPILVFDGCTLPSKKEVERSRRERRQANLLKGKQLLREGKVSEARECFTRSINITHAMAHKVIKAARSQ     71 - 140
GVDCLVAPYEADAQLAYLNKAGIVQAIITEDSDLLAFGCKKVILKMDQFGNGLEIDQARLGMCRQLGDVF    141 - 210
TEEKFRYMCILSGCDYLSSLRGIGLAKACKVLRLANNPDIVKVIKKIGHYLKMNITVPEDYINGFIRANN    211 - 280
TFLYQLVFDPIKRKLIPLNAYEDDVDPETLSYAGQYVDDSIALQIALGNKDINTFEQIDDYNPDTAMPAH    281 - 350
SRSHSWDDKTCQKSANVSSIWHRNYSPRPESGTVSDAPQLKENPSTVGVERVISTKGLNLPRKSSIVKRP    351 - 420
RSAELSEDDLLSQYSLSFTKKTKKNSSEGNKSLSFSEVFVPDLVNGPTNKKSVSTPPRTRNKFATFLQRK    421 - 490
NEESGAVVVPGTRSRFFCSSDSTDCVSNKVSIQPLDETAVTDKENNLHESEYGDQEGKRLVDTDVARNSS    491 - 560
DDIPNNHIPGDHIPDKATVFTDEESYSFESSKFTRTISPPTLGTLRSCFSWSGGLGDFSRTPSPSPSTAL    561 - 630
QQFRRKSDSPTSLPENNMSDVSQLKSEESSDDESHPLREEACSSQSQESGEFSLQSSNASKLSQCSSKDS    631 - 700
DSEESDCNIKLLDSQSDQTSKLRLSHFSKKDTPLRNKVPGLYKSSSADSLSTTKIKPLGPARASGLSKKP    701 - 770
ASIQKRKHHNAENKPGLQIKLNELWKNFGFKKDSEKLPPCKKPLSPVRDNIQLTPEAEEDIFNKPECGRV    771 - 840
QRAIFQ                                                                    841 - 846
//

Text Mined References (106)

PMID Year Title