Property Summary

NCBI Gene PubMed Count 65
PubMed Score 37.89
PubTator Score 65.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Protein-protein Interaction (1)

Gene RIF (40)

AA Sequence

MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEM      1 - 70
KKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQVTGRKA     71 - 140
DVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQK    141 - 210
KDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTL    211 - 280
RAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQ    281 - 350
DAELKALLQSSASRKTQKKKKKKASKTAENATSGETLEENEAGD                              351 - 394
//

Text Mined References (78)

PMID Year Title