Property Summary

NCBI Gene PubMed Count 63
PubMed Score 35.95
PubTator Score 65.02

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UQ80 O43846 Q9UM59
Symbols EBP1
HG4-1
p38-2G4

Gene

PDB

2Q8K   3J2I  

Gene RIF (38)

PMID Text
26436510 The combined determination of Ebp1 and p53 expression levels in cervical cancer patients could support the effective prediction of metastatic potential and patient prognosis.
26256794 EBP1 participates in the regulation of intestinal inflammation via mediating Akt signaling pathway.
26081906 Data highlight the tissue specificity function of EBP1 isoforms and show that only the oncogene p48 activates MHC II expression in human solid tumors, via STAT1 phosphorylation, in order to affect tumor progression by triggering specific immune response.
25917452 Our results suggest a novel function of Ebp1 as a binding protein and negative regulator of Anxa2. The functional association between Anxa2 and EBP1 may participate in regulating cancer cell proliferation and invasion, contributing to cancer progression.
25691158 Data suggest that inhibiting ErbB3-binding protein 1 Ebp1 phosphorylation may be an effective mechanism for inhibiting T-cell activation and proliferation.
25154617 P48Ebp1 acts as an oncoprotein.
24798454 Ebp1 functionality is independent from heat-shock-protein-regulated progression networks in prostate cancer.
24651434 Ebp1 p42 isoform regulates the proteasomal degradation of the p85 regulatory subunit of PI3K by recruiting a chaperone-E3 ligase complex HSP70/CHIP.
23828502 data suggest that Vpr may inhibit Ebp1 to stabilize p53, which in turn leads to G2 arrest and apoptosis in U87MG cells
23828502 HIV-1 Vpr downregulates proliferation-associated protein 2G4 (PA2G4) and upregulates p53 in glioblastoma U87MG cells
More...

AA Sequence

MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEM      1 - 70
KKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQVTGRKA     71 - 140
DVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQK    141 - 210
KDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTL    211 - 280
RAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQ    281 - 350
DAELKALLQSSASRKTQKKKKKKASKTAENATSGETLEENEAGD                              351 - 394
//

Text Mined References (75)

PMID Year Title
27346687 2016 DNAJC21 Mutations Link a Cancer-Prone Bone Marrow Failure Syndrome to Corruption in 60S Ribosome Subunit Maturation.
26436510 2015 Significance of Ebp1 and p53 protein expression in cervical cancer.
26256794 2015 ErbB3 binding protein 1 (EBP1) participates in the regulation of intestinal inflammation via mediating Akt signaling pathway.
26081906 2015 EBP1 protein modulates the expression of human MHC class II molecules in non-hematopoietic cancer cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25917452 2015 A novel Anxa2-interacting protein Ebp1 inhibits cancer proliferation and invasion by suppressing Anxa2 protein level.
25691158 2015 Regulation of ribosomal RNA synthesis in T cells: requirement for GTP and Ebp1.
25154617 2015 Phosphorylation of the N-terminal domain of p48 Ebp1 by CDK2 is required for tumorigenic function of p48.
24798454 2015 Androgen receptor (AR) inhibitor ErbB3-binding protein-1 (Ebp1) is not targeted by the newly identified AR controlling signaling axis heat-shock protein HSP27 and microRNA miR-1 in prostate cancer cells.
24651434 2014 P42 Ebp1 regulates the proteasomal degradation of the p85 regulatory subunit of PI3K by recruiting a chaperone-E3 ligase complex HSP70/CHIP.
More...