Property Summary

NCBI Gene PubMed Count 27
PubMed Score 39.89
PubTator Score 20.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Small cell carcinoma of lung 45
Disease Target Count P-value
lung carcinoma 2844 2.92991965742078E-56
astrocytoma 1493 2.48818729289211E-15
ependymoma 2514 5.45579331250641E-13
malignant mesothelioma 3163 1.32849829348362E-8
oligodendroglioma 2849 1.34653133794139E-8
adult high grade glioma 2148 4.0891939775339E-7
pilocytic astrocytoma 3086 5.05057318146285E-7
osteosarcoma 7933 7.53082805383925E-7
atypical teratoid / rhabdoid tumor 4369 1.85139021697572E-6
glioblastoma 5572 2.19766078049796E-5
medulloblastoma, large-cell 6234 0.00131594341587404
primitive neuroectodermal tumor 3031 0.00178109193008379
medulloblastoma 1524 0.00202293344804649
Pick disease 1893 0.0135050784090999
interstitial cystitis 2299 0.0225450997928986
subependymal giant cell astrocytoma 2287 0.0262942165896671
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Laryngotracheitis 10 4.05 2.0
Focal hand dystonia 2 3.758 1.9
Croup 12 3.664 1.8

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 3.500 0.000
astrocytoma -2.500 0.000
ependymoma -4.300 0.000
glioblastoma -4.300 0.000
oligodendroglioma -1.800 0.000
osteosarcoma 1.414 0.000
medulloblastoma -2.200 0.002
atypical teratoid / rhabdoid tumor -4.500 0.000
medulloblastoma, large-cell -2.100 0.001
primitive neuroectodermal tumor -2.900 0.002
interstitial cystitis -1.600 0.023
adult high grade glioma -4.200 0.000
pilocytic astrocytoma -2.500 0.000
subependymal giant cell astrocytoma -3.165 0.026
lung carcinoma 4.600 0.000
Pick disease -1.200 0.014

Synonym

Accession Q9UQ26 B3KX91 F8WD47 O43413 Q86XL9 Q8IWV9 Q8IWW1
Symbols OBOE
RIM2
RAB3IP3

Gene

PANTHER Protein Class (2)

PDB

1V27   1WFG  

  Ortholog (7)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid

 GWAS Trait (1)

Gene RIF (6)

PMID Text
22248876 Here, we report that, like Rab3A, RIM and Munc13 are present in human sperm and that they play a functional role in acrosomal exocytosis before the acrosomal calcium efflux
20520587 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20363327 These data suggest that RIM2beta contributes to the stabilization of Ca(v)1.3 gating kinetics in immature cochlear inner hair cells.
19199833 tick-borne encephalitis virus -NS5 has high affinity to regulating synaptic membrane exocytosis-2 (RIMS2) and Scribble, whereas DENV-NS5 binds primarily to the tight junction protein zonula occludens-1 (ZO-1)
18490030 Western blot analysis shows increased RIMS2 protein expression in the amygdala in schizophrenia.

AA Sequence

MSAPVGPRGRLAPIPAASQPPLQPEMPDLSHLTEEERKIILAVMDRQKKKVKEEHKPQLTQWFPFSGITE      1 - 70
LVNNVLQPQQKQQNEKEPQTKLHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCS     71 - 140
YCQTKFCARCGGRVSLRSNKVMWVCNLCRKQQEILTKSGAWFYNSGSNTPQQPDQKVLRGLRNEEAPQEK    141 - 210
KPKLHEQTQFQGPSGDLSVPAVEKSRSHGLTRQHSIKNGSGVKHHIASDIASDRKRSPSVSRDQNRRYDQ    211 - 280
REEREEYSQYATSDTAMPRSPSDYADRRSQHEPQFYEDSDHLSYRDSNRRSHRHSKEYIVDDEDVESRDE    281 - 350
YERQRREEEYQSRYRSDPNLARYPVKPQPYEEQMRIHAEVSRARHERRHSDVSLANADLEDSRISMLRMD    351 - 420
RPSRQRSISERRAAMENQRSYSMERTREAQGPSSYAQRTTNHSPPTPRRSPLPIDRPDLRRTDSLRKQHH    421 - 490
LDPSSAVRKTKREKMETMLRNDSLSSDQSESVRPPPPKPHKSKKGGKMRQISLSSSEEELASTPEYTSCD    491 - 560
DVEIESESVSEKGDSQKGKRKTSEQAVLSDSNTRSERQKEMMYFGGHSLEEDLEWSEPQIKDSGVDTCSS    561 - 630
TTLNEEHSHSDKHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITK    631 - 700
VKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQL    701 - 770
ESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDLPSREDGRP    771 - 840
RNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLG    841 - 910
EILIELETALLDDEPHWYKLQTHDVSSLPLPHPSPYMPRRQLHGESPTRRLQRSKRISDSEVSDYDCDDG    911 - 980
IGVVSDYRHDGRDLQSSTLSVPEQVMSSNHCSPSGSPHRVDVIGRTRSWSPSVPPPQSRNVEQGLRGTRT    981 - 1050
MTGHYNTISRMDRHRVMDDHYSPDRDRDCEAADRQPYHRSRSTEQRPLLERTTTRSRSTERPDTNLMRSM   1051 - 1120
PSLMTGRSAPPSPALSRSHPRTGSVQTSPSSTPVAGRRGRQLPQLPPKGTLDRKAGGKKLRSTVQRSTET   1121 - 1190
GLAVEMRNWMTRQASRESTDGSMNSYSSEGNLIFPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAMGD   1191 - 1260
IQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVARKTLEPLYQQLLSFE   1261 - 1330
ESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSL   1331 - 1400
ESSTGPSYSRS                                                              1401 - 1411
//

Text Mined References (31)

PMID Year Title
24623842 2014 GABRA1 and STXBP1: novel genetic causes of Dravet syndrome.
23999003 2013 SYT14L, especially its C2 domain, is involved in regulating melanocyte differentiation.
23958962 2014 Genome-wide association study of cocaine dependence and related traits: FAM53B identified as a risk gene.
22248876 2012 RIM, Munc13, and Rab3A interplay in acrosomal exocytosis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20520587 2010 Genome-wide association study identifies genes that may contribute to risk for developing heroin addiction.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20363327 2010 Modulation of Cav1.3 Ca2+ channel gating by Rab3 interacting molecule.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19199833 2009 Flavivirus NS5 associates with host-cell proteins zonula occludens-1 (ZO-1) and regulating synaptic membrane exocytosis-2 (RIMS2) via an internal PDZ binding mechanism.
More...