Property Summary

NCBI Gene PubMed Count 27
Grant Count 13
R01 Count 4
Funding $1,765,491.83
PubMed Score 39.89
PubTator Score 20.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 3.500 0.000
astrocytoma -2.500 0.000
ependymoma -4.300 0.000
glioblastoma -4.300 0.000
oligodendroglioma -1.800 0.000
osteosarcoma 1.414 0.000
medulloblastoma -2.200 0.002
atypical teratoid / rhabdoid tumor -4.500 0.000
medulloblastoma, large-cell -2.100 0.001
primitive neuroectodermal tumor -2.900 0.002
interstitial cystitis -1.600 0.023
adult high grade glioma -4.200 0.000
pilocytic astrocytoma -2.500 0.000
subependymal giant cell astrocytoma -3.165 0.026
lung carcinoma 4.600 0.000
Pick disease -1.200 0.014

Gene RIF (6)

PMID Text
22248876 Here, we report that, like Rab3A, RIM and Munc13 are present in human sperm and that they play a functional role in acrosomal exocytosis before the acrosomal calcium efflux
20520587 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20363327 These data suggest that RIM2beta contributes to the stabilization of Ca(v)1.3 gating kinetics in immature cochlear inner hair cells.
19199833 tick-borne encephalitis virus -NS5 has high affinity to regulating synaptic membrane exocytosis-2 (RIMS2) and Scribble, whereas DENV-NS5 binds primarily to the tight junction protein zonula occludens-1 (ZO-1)
18490030 Western blot analysis shows increased RIMS2 protein expression in the amygdala in schizophrenia.

AA Sequence

MSAPVGPRGRLAPIPAASQPPLQPEMPDLSHLTEEERKIILAVMDRQKKKVKEEHKPQLTQWFPFSGITE      1 - 70
LVNNVLQPQQKQQNEKEPQTKLHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCS     71 - 140
YCQTKFCARCGGRVSLRSNKVMWVCNLCRKQQEILTKSGAWFYNSGSNTPQQPDQKVLRGLRNEEAPQEK    141 - 210
KPKLHEQTQFQGPSGDLSVPAVEKSRSHGLTRQHSIKNGSGVKHHIASDIASDRKRSPSVSRDQNRRYDQ    211 - 280
REEREEYSQYATSDTAMPRSPSDYADRRSQHEPQFYEDSDHLSYRDSNRRSHRHSKEYIVDDEDVESRDE    281 - 350
YERQRREEEYQSRYRSDPNLARYPVKPQPYEEQMRIHAEVSRARHERRHSDVSLANADLEDSRISMLRMD    351 - 420
RPSRQRSISERRAAMENQRSYSMERTREAQGPSSYAQRTTNHSPPTPRRSPLPIDRPDLRRTDSLRKQHH    421 - 490
LDPSSAVRKTKREKMETMLRNDSLSSDQSESVRPPPPKPHKSKKGGKMRQISLSSSEEELASTPEYTSCD    491 - 560
DVEIESESVSEKGDSQKGKRKTSEQAVLSDSNTRSERQKEMMYFGGHSLEEDLEWSEPQIKDSGVDTCSS    561 - 630
TTLNEEHSHSDKHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITK    631 - 700
VKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQL    701 - 770
ESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDLPSREDGRP    771 - 840
RNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLG    841 - 910
EILIELETALLDDEPHWYKLQTHDVSSLPLPHPSPYMPRRQLHGESPTRRLQRSKRISDSEVSDYDCDDG    911 - 980
IGVVSDYRHDGRDLQSSTLSVPEQVMSSNHCSPSGSPHRVDVIGRTRSWSPSVPPPQSRNVEQGLRGTRT    981 - 1050
MTGHYNTISRMDRHRVMDDHYSPDRDRDCEAADRQPYHRSRSTEQRPLLERTTTRSRSTERPDTNLMRSM   1051 - 1120
PSLMTGRSAPPSPALSRSHPRTGSVQTSPSSTPVAGRRGRQLPQLPPKGTLDRKAGGKKLRSTVQRSTET   1121 - 1190
GLAVEMRNWMTRQASRESTDGSMNSYSSEGNLIFPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAMGD   1191 - 1260
IQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVARKTLEPLYQQLLSFE   1261 - 1330
ESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSL   1331 - 1400
ESSTGPSYSRS                                                              1401 - 1411
//

Text Mined References (31)

PMID Year Title
24623842 2014 GABRA1 and STXBP1: novel genetic causes of Dravet syndrome.
23999003 2013 SYT14L, especially its C2 domain, is involved in regulating melanocyte differentiation.
23958962 2014 Genome-wide association study of cocaine dependence and related traits: FAM53B identified as a risk gene.
22248876 2012 RIM, Munc13, and Rab3A interplay in acrosomal exocytosis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20520587 2010 Genome-wide association study identifies genes that may contribute to risk for developing heroin addiction.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20363327 2010 Modulation of Cav1.3 Ca2+ channel gating by Rab3 interacting molecule.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19199833 2009 Flavivirus NS5 associates with host-cell proteins zonula occludens-1 (ZO-1) and regulating synaptic membrane exocytosis-2 (RIMS2) via an internal PDZ binding mechanism.
More...