Property Summary

NCBI Gene PubMed Count 12
Grant Count 31
R01 Count 21
Funding $3,566,654.37
PubMed Score 386.02
PubTator Score 7.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (10)

PMID Text
24734329 Some genetical studies show also altered expression of the dehydrogenases ALDH2 and DHDH genes in patients with Dupuytren's disease and with digestive tract malignancies related to alcohol abuse.(review)
23303836 Possible association of both variants of the DHDH gene with familial Dupuytren's disease, as over-representation of the rs2270941 and rs11666105 alterations was identified among 100 patients with a familial history.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18600452 Survival was significantly better in gastric cancer patients with low DDH expression.
11306093 Comparison of other mammalian homologs with the human enzyme shows that dimeric DDs constitute a novel protein family.
11097839 Site-directed mutagenesis of conserved residues shows that Tyr-180 plays a critical role in the catalytic function of this enzyme, while His-79 is required in the coenzyme binding and chemical steps of the reaction.

AA Sequence

MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVA      1 - 70
YIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLMEAIWTRFFPASEALRSVLA     71 - 140
QGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKISVVGRRHETGVDD    141 - 210
TVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFD    211 - 280
NGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR                    281 - 334
//

Text Mined References (13)

PMID Year Title
24734329 2013 [A coexistence of the Dupuytren's disease and malignant neoplasms: a review].
23303836 2013 Common variants of the ALDH2 and DHDH genes and the risk of Dupuytren's disease.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18600452 2009 Overexpression of dihydrodiol dehydrogenase as a prognostic marker in resected gastric cancer patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...