Property Summary

NCBI Gene PubMed Count 358
PubMed Score 2054.34
PubTator Score 696.53

Knowledge Summary


No data available


  Disease (6)


  Differential Expression (31)

Disease log2 FC p
acute quadriplegic myopathy 1.040 2.0e-02
adrenocortical carcinoma 1.304 5.8e-04
Alzheimer's disease 1.200 2.7e-02
Amyotrophic lateral sclerosis 1.394 1.2e-06
astrocytic glioma 1.200 4.7e-02
atypical teratoid / rhabdoid tumor 1.700 1.8e-04
Breast cancer -1.300 5.2e-18
Crohn's disease -1.726 5.6e-03
dermatomyositis 2.300 1.3e-04
Gaucher disease type 1 -1.800 3.3e-02
glioblastoma 1.200 1.0e-03
group 4 medulloblastoma 1.100 3.1e-02
hepatocellular carcinoma -1.100 1.5e-05
hereditary spastic paraplegia -1.301 1.4e-02
intraductal papillary-mucinous adenoma (... 1.200 3.8e-02
juvenile dermatomyositis 1.146 1.0e-05
malignant mesothelioma 1.100 1.5e-05
medulloblastoma, large-cell 1.400 1.7e-03
Multiple myeloma 1.048 4.0e-02
osteosarcoma 1.870 1.4e-06
ovarian cancer -1.100 6.6e-06
permanent atrial fibrillation -1.200 1.0e-02
Pick disease 1.300 6.2e-04
primitive neuroectodermal tumor 1.700 5.2e-03
progressive supranuclear palsy -1.100 9.1e-03
psoriasis 1.100 5.1e-05
Rheumatoid arthritis 1.900 2.2e-02
sarcoidosis 1.200 1.3e-02
tuberculosis and treatment for 6 months 2.000 7.4e-05
ulcerative colitis -2.242 6.8e-03
Waldenstrons macroglobulinemia 1.234 3.2e-02

 GWAS Trait (1)

Protein-protein Interaction (2)

PDB (11)

Gene RIF (317)

AA Sequence

KGVGRSYRIAKSAAARRALRSLKANQPQVPNS                                         1891 - 1922

Text Mined References (370)

PMID Year Title