Property Summary

NCBI Gene PubMed Count 305
Grant Count 719
R01 Count 407
Funding $115,548,775.29
PubMed Score 1908.41
PubTator Score 696.53

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UPY3 A7E2D3 B3KRG4 E0AD28 O95943 Q9UQ02
Symbols DCR1
MNG1
Dicer
HERNA
RMSE2
Dicer1e
K12H4.8-LIKE

Gene

PDB

2EB1   4NGB   4NGC   4NGD   4NGF   4NGG   4NH3   4NH5   4NH6   4NHA   4WYQ  

Gene RIF (268)

PMID Text
27264823 Polymorphisms of rs3742330 of the DICER gene, particularly the AA genotype, may be associated with azoospermia.
26976605 An essential role of Dicer in microRNA biogenesis
26965998 this study proposes that inflammation-induced Jak-STAT3 signaling leads to colon cancer development through proteasomal degradation of DICER1 by ubiquitin ligase complex of CUL4A(DCAF1), which suggests a novel therapeutic opportunity for colon cancer
26943961 This work identifies Dicer regulation as both a potential mediator of MS pathology and a therapeutic target.
26921501 we found that both the structural features of shmiR hairpins and the nucleotide sequence at Drosha and Dicer processing sites contribute to cleavage site selection and cleavage precision.
26858029 the expression of MYCN, HMGA2, and DICER1 seems to be correlated to each other and the expression of the let7-genes impacted by their expression.
26837267 Dicer promotes endothelial maladaptation and atherosclerosis in part by miR-103-mediated suppression of KLF4.
26772403 our results emphasize the high prevalence of DICER1 mutations in pediatric cystic nephromas
26748703 essential function of Dicer in resolving the spontaneous DNA damage that occurs during the rapid proliferation of developmental progenitors and malignant cells.
26632874 Expression of DICER1 and microRNA are reduced in post-traumatic stress disorder with comorbid depression.
More...

AA Sequence

MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGK      1 - 70
TFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVNASWTKERWNQ     71 - 140
EFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASIL    141 - 210
NGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNF    211 - 280
INDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDT    281 - 350
FLRKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDE    351 - 420
DEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPR    421 - 490
NKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNY    491 - 560
IMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSVDTGETDIDPVMDDDDVFPPYVLRPDDGGPRVTINTA    561 - 630
IGHINRYCARLPSDPFTHLAPKCRTRELPDGTFYSTLYLPINSPLRASIVGPPMSCVRLAERVVALICCE    631 - 700
KLHKIGELDDHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRDSYPRPDQPCYL    701 - 770
YVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFMLSL    771 - 840
QMLELITRLHQYIFSHILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIP    841 - 910
STKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDL    911 - 980
TNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRK    981 - 1050
AVCLPSILYRLHCLLTAEELRAQTASDAGVGVRSLPADFRYPNLDFGWKKSIDSKSFISISNSSSAENDN   1051 - 1120
YCKHSTIVPENAAHQGANRTSSLENHDQMSVNCRTLLSESPGKLHVEVSADLTAINGLSYNQNLANGSYD   1121 - 1190
LANRDFCQGNQLNYYKQEIPVQPTTSYSIQNLYSYENQPQPSDECTLLSNKYLDGNANKSTSDGSPVMAV   1191 - 1260
MPGTTDTIQVLKGRMDSEQSPSIGYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGDSFLKHAITTY   1261 - 1330
LFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKSNTDKWEKD   1331 - 1400
EMTKDCMLANGKLDEDYEEEDEEEESLMWRAPKEEADYEDDFLEYDQEHIRFIDNMLMGSGAFVKKISLS   1401 - 1470
PFSTTDSAYEWKMPKKSSLGSMPFSSDFEDFDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTG   1471 - 1540
KQSISYDLHTEQCIADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCPTRENF   1541 - 1610
NSQQKNLSVSCAAASVASSRSSVLKDSEYGCLKIPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNK   1611 - 1680
AYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAV   1681 - 1750
KYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKEEDIEVPKAMGDIFESLAGAIY   1751 - 1820
MDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKF   1821 - 1890
KGVGRSYRIAKSAAARRALRSLKANQPQVPNS                                         1891 - 1922
//

Text Mined References (318)

PMID Year Title
27264823 2016 [Association of polymorphisms of miRNA biogenesis related genes DICER and DROSHA with azoospermia].
26976605 2016 Re-evaluation of the roles of DROSHA, Export in 5, and DICER in microRNA biogenesis.
26965998 2016 Jak-STAT3 pathway triggers DICER1 for proteasomal degradation by ubiquitin ligase complex of CUL4A(DCAF1) to promote colon cancer development.
26943961 2016 Dicer and microRNA expression in multiple sclerosis and response to interferon therapy.
26921501 2016 siRNA release from pri-miRNA scaffolds is controlled by the sequence and structure of RNA.
26858029 2016 The MYCN-HMGA2-CDKN2A pathway in non-small cell lung carcinoma--differences in histological subtypes.
26837267 2016 Endothelial Dicer promotes atherosclerosis and vascular inflammation by miRNA-103-mediated suppression of KLF4.
26772403 2016 Pediatric cystic nephromas: distinctive features and frequent DICER1 mutations.
26748703 2016 Essential Function of Dicer in Resolving DNA Damage in the Rapidly Dividing Cells of the Developing and Malignant Cerebellum.
26632874 2015 DICER1 and microRNA regulation in post-traumatic stress disorder with comorbid depression.
More...