Property Summary

NCBI Gene PubMed Count 31
Grant Count 2
R01 Count 2
Funding $167,596
PubMed Score 10.44
PubTator Score 9.87

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UPV9 E9PDS2 J3KNT7 Q63HR0 Q659B5 Q96B69
Symbols MILT1
OIP106

Gene

PANTHER Protein Class (1)

 Grant Application (2)

Gene RIF (10)

PMID Text
25653102 This study showed that the TRAK1 was prevalently localized in axons of hippocampal and cortical neurons.
24995978 By mapping and mutating four key sites of GlcNAc addition in hMilton1 (hMilton1Qmut), study demonstrated that Milton is the key and essential substrate through which OGT inhibits mitochondrial motility.
24975273 Data suggest that vitamin D receptor target genes (TRAK1; DUSP10, dual specificity phosphatase 10; NRIP1, nuclear receptor interacting protein 1; THBD, thrombomodulin) can be used as markers for individual's response to vitamin D3 supplements.
24092329 Details of a robust association of DISC1 with mitochondrial transport complexes containing TRAK1 and Miro1.
23395375 The results of this study established a key role for mammalian TRAK1 proteins in axonal and dendritic targeting of mitochondria.
21573901 MGb2-Ag/TRAK1 may play an important role in the development of colorectal cancer (CRC) and may be a valuable prognostic indicator of CRC.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18986759 TRAK1/MGb2-Ag is a promising diagnostic marker for gastric cancer and may help to detect signet-ring cell carcinoma and mucinous adenocarcinoma
18675823 Data show that Trak1 interacts with hepatocyte-growth-factor-regulated tyrosine kinase substrate (Hrs), an essential component of the endosomal sorting and trafficking machinery.
15644324 GRIF-1 and OIP106 have roles in protein and/or organelle transport in excitable cells in a manner analogous to glutamate receptor-interacting-protein 1

AA Sequence

MALVFQFGQPVRAQPLPGLCHGKLIRTNACDVCNSTDLPEVEIISLLEEQLPHYKLRADTIYGYDHDDWL      1 - 70
HTPLISPDANIDLTTEQIEETLKYFLLCAERVGQMTKTYNDIDAVTRLLEEKERDLELAARIGQSLLKKN     71 - 140
KTLTERNELLEEQVEHIREEVSQLRHELSMKDELLQFYTSAAEESEPESVCSTPLKRNESSSSVQNYFHL    141 - 210
DSLQKKLKDLEEENVVLRSEASQLKTETITYEEKEQQLVNDCVKELRDANVQIASISEELAKKTEDAARQ    211 - 280
QEEITHLLSQIVDLQKKAKACAVENEELVQHLGAAKDAQRQLTAELRELEDKYAECMEMLHEAQEELKNL    281 - 350
RNKTMPNTTSRRYHSLGLFPMDSLAAEIEGTMRKELQLEEAESPDITHQKRVFETVRNINQVVKQRSLTP    351 - 420
SPMNIPGSNQSSAMNSLLSSCVSTPRSSFYGSDIGNVVLDNKTNSIILETEAADLGNDERSKKPGTPGTP    421 - 490
GSHDLETALRRLSLRRENYLSERRFFEEEQERKLQELAEKGELRSGSLTPTESIMSLGTHSRFSEFTGFS    491 - 560
GMSFSSRSYLPEKLQIVKPLEGSATLHHWQQLAQPHLGGILDPRPGVVTKGFRTLDVDLDEVYCLNDFEE    561 - 630
DDTGDHISLPRLATSTPVQHPETSAHHPGKCMSQTNSTFTFTTCRILHPSDELTRVTPSLNSAPTPACGS    631 - 700
TSHLKSTPVATPCTPRRLSLAESFTNTRESTTTMSTSLGLVWLLKERGISAAVYDPQSWDRAGRGSLLHS    701 - 770
YTPKMAVIPSTPPNSPMQTPTSSPPSFEFKCTSPPYDNFLASKPASSILREVREKNVRSSESQTDVSVSN    771 - 840
LNLVDKVRRFGVAKVVNSGRAHVPTLTEEQGPLLCGPPGPAPALVPRGLVPEGLPLRCPTVTSAIGGLQL    841 - 910
NSGIRRNRSFPTMVGSSMQMKAPVTLTSGILMGAKLSKQTSLR                               911 - 953
//

Text Mined References (35)

PMID Year Title
25653102 2015 Localization of the kinesin adaptor proteins trafficking kinesin proteins 1 and 2 in primary cultures of hippocampal pyramidal and cortical neurons.
24995978 2014 Glucose regulates mitochondrial motility via Milton modification by O-GlcNAc transferase.
24975273 2014 Changes in vitamin D target gene expression in adipose tissue monitor the vitamin D response of human individuals.
24092329 2014 DISC1 complexes with TRAK1 and Miro1 to modulate anterograde axonal mitochondrial trafficking.
23395375 2013 TRAK/Milton motor-adaptor proteins steer mitochondrial trafficking to axons and dendrites.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
21573901 2011 Elevated expression of MGb2-Ag/TRAK1 is correlated with poor prognosis in patients with colorectal cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...