Property Summary

NCBI Gene PubMed Count 3
Grant Count 32
R01 Count 11
Funding $7,506,692.34
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.800 0.003
ependymoma -4.100 0.000
oligodendroglioma -2.700 0.000
cutaneous lupus erythematosus -1.100 0.011
psoriasis -1.500 0.002
glioblastoma -4.700 0.000
medulloblastoma -4.800 0.000
atypical teratoid / rhabdoid tumor -4.800 0.000
medulloblastoma, large-cell -5.100 0.000
primitive neuroectodermal tumor -4.100 0.000
adult high grade glioma -4.100 0.000
pilocytic astrocytoma -4.100 0.000

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MGVLMSKRQTVEQVQKVSLAVSAFKDGLRDRPSIRRTGELPGSRRGTVEGSVQEVQEEKEAEAGTSVVQE      1 - 70
ESSAGRAAWERLRDGRGVEPEEFDRTSRFTPPAFIRPTRKLDDDKPPEICLEPREPVVNDEMCDVCEVWT     71 - 140
AESLFPCRVCTRVFHDGCLRRMGYIQGDSAAEVTEMAHTETGWSCHYCDNINLLLTEEEMYSLTETFQRC    141 - 210
KVIPDCSLTLEDFLRYRHQAAKRGDRDRALSEEQEEQAARQFAALDPEHRGHIEWPDFLSHESLLLLQQL    211 - 280
RPQNSLLRLLTVKERERARAAFLARGSGSTVSEAECRRAQHSWFCKRFPEAPSCSVSISHVGPIADSSPA    281 - 350
SSSSKSQDKTLLPTEQESRFVDWPTFLQENVLYILAARPNSAAIHLKPPG                        351 - 400
//

Text Mined References (6)

PMID Year Title
20213681 2010 Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.