Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.400 5.5e-04
astrocytic glioma -1.900 3.9e-03
Astrocytoma, Pilocytic -2.800 5.5e-08
atypical teratoid / rhabdoid tumor -2.800 4.0e-08
cutaneous lupus erythematosus -1.100 1.1e-02
ependymoma -2.300 1.4e-03
glioblastoma -2.600 1.4e-09
group 3 medulloblastoma -3.200 6.3e-04
medulloblastoma, large-cell -2.800 3.3e-04
oligodendroglioma -2.300 1.4e-02
primitive neuroectodermal tumor -2.800 2.4e-05
psoriasis -1.500 1.7e-03

AA Sequence

MGVLMSKRQTVEQVQKVSLAVSAFKDGLRDRPSIRRTGELPGSRRGTVEGSVQEVQEEKEAEAGTSVVQE      1 - 70
ESSAGRAAWERLRDGRGVEPEEFDRTSRFTPPAFIRPTRKLDDDKPPEICLEPREPVVNDEMCDVCEVWT     71 - 140
AESLFPCRVCTRVFHDGCLRRMGYIQGDSAAEVTEMAHTETGWSCHYCDNINLLLTEEEMYSLTETFQRC    141 - 210
KVIPDCSLTLEDFLRYRHQAAKRGDRDRALSEEQEEQAARQFAALDPEHRGHIEWPDFLSHESLLLLQQL    211 - 280
RPQNSLLRLLTVKERERARAAFLARGSGSTVSEAECRRAQHSWFCKRFPEAPSCSVSISHVGPIADSSPA    281 - 350
SSSSKSQDKTLLPTEQESRFVDWPTFLQENVLYILAARPNSAAIHLKPPG                        351 - 400
//

Text Mined References (6)

PMID Year Title