Property Summary

NCBI Gene PubMed Count 11
Grant Count 5
R01 Count 5
Funding $879,618
PubMed Score 5.51
PubTator Score 7.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma -1.400 0.044
posterior fossa group A ependymoma -2.600 0.000
group 3 medulloblastoma -2.600 0.000
medulloblastoma, large-cell -2.000 0.003
adult high grade glioma -1.100 0.003
pilocytic astrocytoma 1.300 0.000
Pick disease -1.100 0.002
pituitary cancer -1.900 0.000
psoriasis -1.100 0.000

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
15710408 The propeptide is not a requirement for normal processing of the receptor and does not prevent ligands from binding to the SorCS3 precursor form

AA Sequence

MEAARTERPAGRPGAPLVRTGLLLLSTWVLAGAEITWDATGGPGRPAAPASRPPALSPLSPRAVASQWPE      1 - 70
ELASARRAAVLGRRAGPELLPQQGGGRGGEMQVEAGGTSPAGERRGRGIPAPAKLGGARRSRRAQPPITQ     71 - 140
ERGDAWATAPADGSRGSRPLAKGSREEVKAPRAGGSAAEDLRLPSTSFALTGDSAHNQAMVHWSGHNSSV    141 - 210
ILILTKLYDFNLGSVTESSLWRSTDYGTTYEKLNDKVGLKTVLSYLYVNPTNKRKIMLLSDPEMESSILI    211 - 280
SSDEGATYQKYRLTFYIQSLLFHPKQEDWVLAYSLDQKLYSSMDFGRRWQLMHERITPNRFYWSVAGLDK    281 - 350
EADLVHMEVRTTDGYAHYLTCRIQECAETTRSGPFARSIDISSLVVQDEYIFIQVTTSGRASYYVSYRRE    351 - 420
AFAQIKLPKYSLPKDMHIISTDENQVFAAVQEWNQNDTYNLYISDTRGIYFTLAMENIKSSRGLMGNIII    421 - 490
ELYEVAGIKGIFLANKKVDDQVKTYITYNKGRDWRLLQAPDVDLRGSPVHCLLPFCSLHLHLQLSENPYS    491 - 560
SGRISSKETAPGLVVATGNIGPELSYTDIGVFISSDGGNTWRQIFDEEYNVWFLDWGGALVAMKHTPLPV    561 - 630
RHLWVSFDEGHSWDKYGFTSVPLFVDGALVEAGMETHIMTVFGHFSLRSEWQLVKVDYKSIFSRHCTKED    631 - 700
YQTWHLLNQGEPCVMGERKIFKKRKPGAQCALGRDHSGSVVSEPCVCANWDFECDYGYERHGESQCVPAF    701 - 770
WYNPASPSKDCSLGQSYLNSTGYRRIVSNNCTDGLREKYTAKAQMCPGKAPRGLHVVTTDGRLVAEQGHN    771 - 840
ATFIILMEEGDLQRTNIQLDFGDGIAVSYANFSPIEDGIKHVYKSAGIFQVTAYAENNLGSDTAVLFLHV    841 - 910
VCPVEHVHLRVPFVAIRNKEVNISAVVWPSQLGTLTYFWWFGNSTKPLITLDSSISFTFLAEGTDTITVQ    911 - 980
VAAGNALIQDTKEIAVHEYFQSQLLSFSPNLDYHNPDIPEWRKDIGNVIKRALVKVTSVPEDQILIAVFP    981 - 1050
GLPTSAELFILPPKNLTERRKGNEGDLEQIVETLFNALNQNLVQFELKPGVQVIVYVTQLTLAPLVDSSA   1051 - 1120
GHSSSAMLMLLSVVFVGLAVFLIYKFKRKIPWINIYAQVQHDKEQEMIGSVSQSENAPKITLSDFTEPEE   1121 - 1190
LLDKELDTRVIGGIATIANSESTKEIPNCTSV                                         1191 - 1222
//

Text Mined References (11)

PMID Year Title
25332075 2015 The role of the retromer complex in aging-related neurodegeneration: a molecular and genomic review.
23673467 2013 Independent and epistatic effects of variants in VPS10-d receptors on Alzheimer disease risk and processing of the amyloid precursor protein (APP).
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19434368 2009 The Vps10p-domain receptor family.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15710408 2005 SorCS3 does not require propeptide cleavage to bind nerve growth factor.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11499680 2001 The genes for the human VPS10 domain-containing receptors are large and contain many small exons.
10600506 1999 Identification and characterization of SorCS, a third member of a novel receptor family.
More...