Property Summary

NCBI Gene PubMed Count 14
PubMed Score 77.21
PubTator Score 10.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 9.4e-05
Breast cancer 1.100 6.7e-04
glioblastoma 1.100 2.7e-04
ovarian cancer 1.100 2.9e-04

 GO Function (1)

Gene RIF (4)

AA Sequence

MTRECPSPAPGPGAPLSGSVLAEAAVVFAVVLSIHATVWDRYSWCAVALAVQAFYVQYKWDRLLQQGSAV      1 - 70
FQFRMSANSGLLPASMVMPLLGLVMKERCQTAGNPFFERFGIVVAATGMAVALFSSVLALGITRPVPTNT     71 - 140
CVILGLAGGVIIYIMKHSLSVGEVIEVLEVLLIFVYLNMILLYLLPRCFTPGEALLVLGGISFVLNQLIK    141 - 210
RSLTLVESQGDPVDFFLLVVVVGMVLMGIFFSTLFVFMDSGTWASSIFFHLMTCVLSLGVVLPWLHRLIR    211 - 280
RNPLLWLLQFLFQTDTRIYLLAYWSLLATLACLVVLYQNAKRSSSESKKHQAPTIARKYFHLIVVATYIP    281 - 350
GIIFDRPLLYVAATVCLAVFIFLEYVRYFRIKPLGHTLRSFLSLFLDERDSGPLILTHIYLLLGMSLPIW    351 - 420
LIPRPCTQKGSLGGARALVPYAGVLAVGVGDTVASIFGSTMGEIRWPGTKKTFEGTMTSIFAQIISVALI    421 - 490
LIFDSGVDLNYSYAWILGSISTVSLLEAYTTQIDNLLLPLYLLILLMA                          491 - 538
//

Text Mined References (13)

PMID Year Title