Property Summary

Ligand Count 3
NCBI Gene PubMed Count 34
PubMed Score 20.89
PubTator Score 24.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.400 3.9e-04
astrocytoma 1.100 3.7e-02
atypical teratoid / rhabdoid tumor -1.600 3.0e-09
Breast cancer -2.700 3.1e-02
colon cancer -1.200 2.7e-03
diabetes mellitus -1.300 2.4e-03
ependymoma -1.100 1.0e-08
glioblastoma -1.100 2.5e-06
group 4 medulloblastoma -1.200 7.9e-04
interstitial cystitis 1.200 2.4e-02
intraductal papillary-mucinous adenoma (... -1.500 2.1e-04
lung adenocarcinoma -1.327 5.8e-07
medulloblastoma, large-cell -1.600 2.1e-06
non-small cell lung cancer -1.676 1.7e-16
osteosarcoma -1.434 2.1e-02
pancreatic ductal adenocarcinoma liver m... 1.194 1.1e-02
Pick disease -1.100 2.4e-06
pituitary cancer 1.800 1.4e-05
primitive neuroectodermal tumor -1.200 1.9e-05

Gene RIF (28)

AA Sequence

MGSSEVSIIPGLQKEEKAAVERRRLHVLKALKKLRIEADEAPVVAVLGSGGGLRAHIACLGVLSEMKEQG      1 - 70
LLDAVTYLAGVSGSTWAISSLYTNDGDMEALEADLKHRFTRQEWDLAKSLQKTIQAARSENYSLTDFWAY     71 - 140
MVISKQTRELPESHLSNMKKPVEEGTLPYPIFAAIDNDLQPSWQEARAPETWFEFTPHHAGFSALGAFVS    141 - 210
ITHFGSKFKKGRLVRTHPERDLTFLRGLWGSALGNTEVIREYIFDQLRNLTLKGLWRRAVANAKSIGHLI    211 - 280
FARLLRLQESSQGEHPPPEDEGGEPEHTWLTEMLENWTRTSLEKQEQPHEDPERKGSLSNLMDFVKKTGI    281 - 350
CASKWEWGTTHNFLYKHGGIRDKIMSSRKHLHLVDAGLAINTPFPLVLPPTREVHLILSFDFSAGDPFET    351 - 420
IRATTDYCRRHKIPFPQVEEAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIEAWSDTYDTFK    421 - 490
LADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKDSARSCCLA                       491 - 541
//

Text Mined References (38)

PMID Year Title