Property Summary

NCBI Gene PubMed Count 32
PubMed Score 20.56
PubTator Score 24.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.6771519038051E-16
sonic hedgehog group medulloblastoma 1482 2.80618182918879E-9
atypical teratoid / rhabdoid tumor 4369 1.66187718473112E-7
lung adenocarcinoma 2714 5.77234430572735E-7
Pick disease 1893 2.39180573551945E-6
ependymoma 2514 9.78133999561727E-6
pituitary cancer 1972 1.42842961708551E-5
medulloblastoma, large-cell 6234 1.66090476361699E-5
pediatric high grade glioma 2712 3.22072694513239E-5
primitive neuroectodermal tumor 3031 5.87798989562632E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 2.14276873898787E-4
glioblastoma 5572 3.70413151673667E-4
diabetes mellitus 1663 0.00241204870361513
colon cancer 1475 0.00265133727322611
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0105790087113685
osteosarcoma 7933 0.0210433010549049
interstitial cystitis 2299 0.0244000251256582
Breast cancer 3099 0.0310610591212692
astrocytoma 1493 0.0365465421587214
Disease Target Count Z-score Confidence
Schizophrenia 503 3.263 1.6

Expression

  Differential Expression (19)

Synonym

Accession Q9UP65 B2RB71 B4DI40 O75457 Q6IBI8 Q9UG68 cPLA2-gamma
Symbols CPLA2-gamma

Gene

PANTHER Protein Class (3)

  Ortholog (1)

Species Source
Mouse OMA Inparanoid

Gene RIF (26)

PMID Text
26160611 Results demonstrated no significant impact of PLA2G6 and PLA2G4C gene polymorphisms on attenuated niacin skin flushing in schizophrenia patients.
23025307 HIV-1 Tat upregulates phospholipase A2, group IVC (PLA2G4C) expression in Jurkat T-cells
22878031 site-specific cytosine methylation of the CpT of PLA2G4C may play a role in the pathogenesis of schizophrenia.
22108055 These findings suggest that IVC-PLA(2) is involved in regulations of macrophage differentiation and macrophage polarization.
21600875 these results suggest that cPLA(2)gamma plays an important role in cancer cell chemotaxis.
21184677 Findings suggest that variation in PLA2G4C may influence preterm birth risk by increasing levels of prostaglandins, which are known to regulate labor.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20452986 cPLA(2) has a role in the induction of cell autonomous cellular immunity to Chlamydia
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20016400 locus showed a weak association with schizophrenia in a Chinese population
More...

AA Sequence

MGSSEVSIIPGLQKEEKAAVERRRLHVLKALKKLRIEADEAPVVAVLGSGGGLRAHIACLGVLSEMKEQG      1 - 70
LLDAVTYLAGVSGSTWAISSLYTNDGDMEALEADLKHRFTRQEWDLAKSLQKTIQAARSENYSLTDFWAY     71 - 140
MVISKQTRELPESHLSNMKKPVEEGTLPYPIFAAIDNDLQPSWQEARAPETWFEFTPHHAGFSALGAFVS    141 - 210
ITHFGSKFKKGRLVRTHPERDLTFLRGLWGSALGNTEVIREYIFDQLRNLTLKGLWRRAVANAKSIGHLI    211 - 280
FARLLRLQESSQGEHPPPEDEGGEPEHTWLTEMLENWTRTSLEKQEQPHEDPERKGSLSNLMDFVKKTGI    281 - 350
CASKWEWGTTHNFLYKHGGIRDKIMSSRKHLHLVDAGLAINTPFPLVLPPTREVHLILSFDFSAGDPFET    351 - 420
IRATTDYCRRHKIPFPQVEEAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIEAWSDTYDTFK    421 - 490
LADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKDSARSCCLA                       491 - 541
//

Text Mined References (36)

PMID Year Title
26160611 2015 Polymorphisms in PLA2G6 and PLA2G4C genes for calcium-independent phospholipase A2 do not contribute to attenuated niacin skin flush response in schizophrenia patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22878031 2012 The DNA methylation profile of PLA2G4C gene promoter in schizophrenia.
22108055 2011 Regulation of macrophage differentiation and polarization by group IVC phospholipase A?.
21600875 2011 Downregulation of cPLA2? expression inhibits EGF-induced chemotaxis of human breast cancer cells through Akt pathway.
21184677 2010 Primate-specific evolution of noncoding element insertion into PLA2G4C and human preterm birth.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20452986 2010 cPLA2 regulates the expression of type I interferons and intracellular immunity to Chlamydia trachomatis.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20016400 2010 Lack of genetic association of the PLA2G4C locus with schizophrenia in case-control samples.
More...