Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.95
PubTator Score 52.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.400 1.7e-03
atypical teratoid / rhabdoid tumor 1.400 5.6e-04
glioblastoma 1.400 4.7e-05
group 3 medulloblastoma 2.000 1.2e-03
intraductal papillary-mucinous neoplasm ... 1.500 9.1e-03
lung cancer 1.700 7.8e-04
medulloblastoma, large-cell 2.700 6.3e-06
nasopharyngeal carcinoma 1.100 2.9e-04
ovarian cancer 1.300 9.7e-05
primitive neuroectodermal tumor 1.200 4.7e-03
psoriasis 1.300 2.9e-03

Gene RIF (7)

AA Sequence

MEEVRCPEHGTFCFLKTGVRDGPNKGKSFYVCRADTCSFVRATDIPVSHCLLHEDFVVELQGLLLPQDKK      1 - 70
EYRLFFRCIRSKAEGKRWCGSIPWQDPDSKEHSVSNKSQHASETFHHSSNWLRNPFKVLDKNQEPALWKQ     71 - 140
LIKGEGEEKKADKKQREKGDQLFDQKKEQKPEMMEKDLSSGLVPKKKQSVVQEKKQEEGAEIQCEAETGG    141 - 210
THKRDFSEIKSQQCQGNELTRPSASSQEKSSGKSQDVQRESEPLREKVTQLLPQNVHSHNSISKPQKGGP    211 - 280
LNKEYTNWEAKETKAKDGPSIQATQKSLPQGHFQERPETHSVPAPGGPAAQAAPAAPGLSLGEGREAATS    281 - 350
SDDEEEDDVVFVSSKPGSPLLFDSTLDLETKENLQFPDRSVQRKVSPASGVSKKVEPSDPVARRVYLTTQ    351 - 420
LKQKKSTLASVNIQALPDKGQKLIKQIQELEEVLSGLTLSPEQGTNEKSNSQVPQQSHFTKTTTGPPHLV    421 - 490
PPQPLPRRGTQPVGSLELKSACQVTAGGSSQCYRGHTNQDHVHAVWKITSEAIGQLHRSLESCPGETVVA    491 - 560
EDPAGLKVPLLLHQKQALAWLLWRESQKPQGGILADDMGLGKTLTMIALILTQKNQEKKEEKEKSTALTW    561 - 630
LSKDDSCDFTSHGTLIICPASLIHHWKNEVEKRVNSNKLRVYLYHGPNRDSRARVLSTYDIVITTYSLVA    631 - 700
KEIPTNKQEAEIPGANLNVEGTSTPLLRIAWARIILDEAHNVKNPRVQTSIAVCKLQACARWAVTGTPIQ    701 - 770
NNLLDMYSLLKFLRCSPFDEFNLWRSQVDNGSKKGGERLSILTKSLLLRRTKDQLDSTGRPLVILPQRKF    771 - 840
QLHHLKLSEDEETVYNVFFARSRSALQSYLKRHESRGNQSGRSPNNPFSRVALEFGSEEPRHSEAADSPR    841 - 910
SSTVHILSQLLRLRQCCCHLSLLKSALDPMELKGEGLVLSLEEQLSALTLSELRDSEPSSTVSLNGTFFK    911 - 980
MELFEGMRESTKISSLLAELEAIQRNSASQKSVIVSQWTNMLKVVALHLKKHGLTYATIDGSVNPKQRMD    981 - 1050
LVEAFNHSRGPQVMLISLLAGGVGLNLTGGNHLFLLDMHWNPSLEDQACDRIYRVGQQKDVVIHRFVCEG   1051 - 1120
TVEEKILQLQEKKKDLAKQVLSGSGESVTKLTLADLRVLFGI                               1121 - 1162
//

Text Mined References (22)

PMID Year Title