Property Summary

NCBI Gene PubMed Count 12
PubMed Score 15.47
PubTator Score 9.15

Knowledge Summary

Patent (472)

Expression

Gene RIF (3)

AA Sequence

MGLARALRRLSGALDSGDSRAGDEEEAGPGLCRNGWAPAPVQSPVGRRRGRFVKKDGHCNVRFVNLGGQG      1 - 70
ARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAAPPPPAPCFSHVASFLAAFLF     71 - 140
ALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFVVGAVMAKMAKPKKRNETLVFSENAVVALRD    141 - 210
HRLCLMWRVGNLRRSHLVEAHVRAQLLQPRVTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDS    211 - 280
ASPLYELGRAELARADFELVVILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFH    281 - 350
RTYEVPGTPVCSAKELDERAEQASHSLKSSFPGSLTAFCYENELALSCCQEEDEDDETEEGNGVETEDGA    351 - 420
ASPRVLTPTLALTLPP                                                          421 - 436
//

Text Mined References (12)

PMID Year Title