Property Summary

NCBI Gene PubMed Count 12
Grant Count 8
R01 Count 4
Funding $1,209,762.6
PubMed Score 14.67
PubTator Score 9.15

Knowledge Summary

Patent (472)

TINX Plot

Expression

Gene RIF (3)

PMID Text
20424473 Observational study of gene-disease association. (HuGE Navigator)
17347781 Using patch-clamp techniques, we characterized K(IR) channels in cultured pulmonary artery smooth muscle cells and compared them to cloned Kir2.1 and Kir2.4 channels
15958527 Kir2.2 and Kir2.1 are primary determinants of endogenous K(+) conductance in HAECs under resting conditions and that Kir2.2 provides the dominant conductance in these cells.

AA Sequence

MGLARALRRLSGALDSGDSRAGDEEEAGPGLCRNGWAPAPVQSPVGRRRGRFVKKDGHCNVRFVNLGGQG      1 - 70
ARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAAPPPPAPCFSHVASFLAAFLF     71 - 140
ALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFVVGAVMAKMAKPKKRNETLVFSENAVVALRD    141 - 210
HRLCLMWRVGNLRRSHLVEAHVRAQLLQPRVTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDS    211 - 280
ASPLYELGRAELARADFELVVILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFH    281 - 350
RTYEVPGTPVCSAKELDERAEQASHSLKSSFPGSLTAFCYENELALSCCQEEDEDDETEEGNGVETEDGA    351 - 420
ASPRVLTPTLALTLPP                                                          421 - 436
//

Text Mined References (12)

PMID Year Title
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
18391953 2008 Rare independent mutations in renal salt handling genes contribute to blood pressure variation.
17347781 2006 Functional expression of inward rectifier potassium channels in cultured human pulmonary smooth muscle cells: evidence for a major role of Kir2.4 subunits.
16382105 2005 International Union of Pharmacology. LIV. Nomenclature and molecular relationships of inwardly rectifying potassium channels.
15958527 2005 Functional expression of Kir2.x in human aortic endothelial cells: the dominant role of Kir2.2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11853319 2001 Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins.
10942728 2000 Cloning and functional expression of human retinal kir2.4, a pH-sensitive inwardly rectifying K(+) channel.
10723734 2000 Cloning, structure and assignment to chromosome 19q13 of the human Kir2.4 inwardly rectifying potassium channel gene (KCNJ14).
More...