Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.46
PubTator Score 6.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
breast carcinoma 1.200 1.4e-02
colon cancer 1.200 1.1e-03
diabetes mellitus -1.100 5.7e-03
group 3 medulloblastoma 1.200 1.5e-03
hepatocellular carcinoma 1.100 5.0e-06
lung cancer 1.700 4.9e-04
ovarian cancer 1.300 7.7e-03
pancreatic cancer 1.100 2.5e-04
pancreatic carcinoma 1.100 2.5e-04

Gene RIF (5)

AA Sequence

MGLTKQYLRYVASAVFGVIGSQKGNIVFVTLRGEKGRYVAVPACEHVFIWDLRKGEKILILQGLKQEVTC      1 - 70
LCPSPDGLHLAVGYEDGSIRIFSLLSGEGNVTFNGHKAAITTLKYDQLGGRLASGSKDTDIIVWDVINES     71 - 140
GLYRLKGHKDAITQALFLREKNLLVTSGKDTMVKWWDLDTQHCFKTMVGHRTEVWGLVLLSEEKRLITGA    141 - 210
SDSELRVWDIAYLQEIEDPEEPDPKKIKGSSPGIQDTLEAEDGAFETDEAPEDRILSCRKAGSIMREGRD    211 - 280
RVVNLAVDKTGRILACHGTDSVLELFCILSKKEIQKKMDKKMKKARKKAKLHSSKGEEEDPEVNVEMSLQ    281 - 350
DEIQRVTNIKTSAKIKSFDLIHSPHGELKAVFLLQNNLVELYSLNPSLPTPQPVRTSRITIGGHRSDVRT    351 - 420
LSFSSDNIAVLSAAADSIKIWNRSTLQCIRTMTCEYALCSFFVPGDRQVVIGTKTGKLQLYDLASGNLLE    421 - 490
TIDAHDGALWSMSLSPDQRGFVTGGADKSVKFWDFELVKDENSTQKRLSVKQTRTLQLDEDVLCVSYSPN    491 - 560
QKLLAVSLLDCTVKIFYVDTLKFFLSLYGHKLPVICMDISHDGALIATGSADRNVKIWGLDFGDCHKSLF    561 - 630
AHDDSVMYLQFVPKSHLFFTAGKDHKIKQWDADKFEHIQTLEGHHQEIWCLAVSPSGDYVVSSSHDKSLR    631 - 700
LWERTREPLILEEEREMEREAEYEESVAKEDQPAVPGETQGDSYFTGKKTIETVKAAERIMEAIELYREE    701 - 770
TAKMKEHKAICKAAGKEVPLPSNPILMAYGSISPSAYVLEIFKGIKSSELEESLLVLPFSYVPDILKLFN    771 - 840
EFIQLGSDVELICRCLFFLLRIHFGQITSNQMLVPVIEKLRETTISKVSQVRDVIGFNMAGLDYLKRECE    841 - 910
AKSEVMFFADATSHLEEKKRKRKKREKLILTLT                                         911 - 943
//

Text Mined References (23)

PMID Year Title