Property Summary

NCBI Gene PubMed Count 39
Grant Count 1
Funding $5,796.2
PubMed Score 12.31
PubTator Score 8.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.183 0.000
osteosarcoma -1.005 0.049
ovarian cancer 1.300 0.001

Synonym

Accession Q9UNS2 B2R683 B4DY81 O43191 Q7LDR6 SGN3
Symbols CSN3
SGN3

Gene

PANTHER Protein Class (1)

 Grant Application (1)

PDB

4D10   4D18   4WSN  

Gene RIF (3)

PMID Text
22237956 this study demonstrates Csn3 as an oncogene that regulates the tumorigenesis process in hepatocellular carcinoma (HCC) cells.
22190034 HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 3 (COPS3; CSN3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21436869 of the COPS3 gene might have important roles in metastasis of osteosarcoma cells.

AA Sequence

MASALEQFVNSVRQLSAQGQMTQLCELINKSGELLAKNLSHLDTVLGALDVQEHSLGVLAVLFVKFSMPS      1 - 70
VPDFETLFSQVQLFISTCNGEHIRYATDTFAGLCHQLTNALVERKQPLRGIGILKQAIDKMQMNTNQLTS     71 - 140
IHADLCQLCLLAKCFKPALPYLDVDMMDICKENGAYDAKHFLCYYYYGGMIYTGLKNFERALYFYEQAIT    141 - 210
TPAMAVSHIMLESYKKYILVSLILLGKVQQLPKYTSQIVGRFIKPLSNAYHELAQVYSTNNPSELRNLVN    211 - 280
KHSETFTRDNNMGLVKQCLSSLYKKNIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFAS    281 - 350
INQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPS    351 - 420
SYS                                                                       421 - 423
//

Text Mined References (51)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26456823 2015 CSNAP Is a Stoichiometric Subunit of the COP9 Signalosome.
26427513 2015 Integrated analysis of gene expression and genomic aberration data in osteosarcoma (OS).
24421388 2014 Dynamic regulation of the COP9 signalosome in response to DNA damage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23695280 2014 Rare copy number variation in cerebral palsy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22631635 2012 Silencing of the COPS3 gene by siRNA reduces proliferation of lung cancer cells most likely via induction of cell cycle arrest and apoptosis.
More...