Property Summary

NCBI Gene PubMed Count 40
PubMed Score 14.17
PubTator Score 8.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Hepatomegaly 285 0.0 0.0
Disease Target Count P-value
Multiple myeloma 1332 4.7e-04
ovarian cancer 8520 1.4e-03
osteosarcoma 7950 4.9e-02
Disease Target Count Z-score Confidence
Smith-Magenis syndrome 29 5.112 2.6

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.005 4.9e-02
Multiple myeloma 1.183 4.7e-04
ovarian cancer 1.300 1.4e-03

Gene RIF (3)

AA Sequence

MASALEQFVNSVRQLSAQGQMTQLCELINKSGELLAKNLSHLDTVLGALDVQEHSLGVLAVLFVKFSMPS      1 - 70
VPDFETLFSQVQLFISTCNGEHIRYATDTFAGLCHQLTNALVERKQPLRGIGILKQAIDKMQMNTNQLTS     71 - 140
IHADLCQLCLLAKCFKPALPYLDVDMMDICKENGAYDAKHFLCYYYYGGMIYTGLKNFERALYFYEQAIT    141 - 210
TPAMAVSHIMLESYKKYILVSLILLGKVQQLPKYTSQIVGRFIKPLSNAYHELAQVYSTNNPSELRNLVN    211 - 280
KHSETFTRDNNMGLVKQCLSSLYKKNIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFAS    281 - 350
INQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPS    351 - 420
SYS                                                                       421 - 423
//

Text Mined References (52)

PMID Year Title