Property Summary

NCBI Gene PubMed Count 64
PubMed Score 577.95
PubTator Score 56.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma 1.651 1.1e-04
adult high grade glioma 1.500 1.9e-04
Atopic dermatitis 1.200 2.6e-06
atypical teratoid / rhabdoid tumor 2.400 1.4e-09
Breast cancer 1.500 2.7e-14
breast carcinoma 1.100 1.7e-35
colon cancer 1.400 1.6e-03
ductal carcinoma in situ 1.100 9.2e-04
glioblastoma 1.800 2.2e-09
group 3 medulloblastoma 3.400 8.9e-09
invasive ductal carcinoma 1.500 1.4e-04
lung adenocarcinoma 1.500 3.1e-11
lung cancer 2.600 8.7e-05
medulloblastoma, large-cell 2.700 6.4e-06
nasopharyngeal carcinoma 1.200 2.9e-05
non-small cell lung cancer 2.034 3.4e-28
osteosarcoma -1.192 3.4e-02
ovarian cancer 1.500 1.9e-04
primitive neuroectodermal tumor 2.600 6.3e-06
psoriasis 1.100 5.4e-13
tuberculosis 1.200 1.4e-05

 MGI Phenotype (1)

Gene RIF (49)

AA Sequence

MDLHMMNCELLATCSALGYLEGDTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQILQSDLLPILT      1 - 70
QHHQDKPLFDAVIRLMVNLTQPALLCFGNLPKEPSFRHHFLQVLTYLQAYKEAFASEKAFGVLSETLYEL     71 - 140
LQLGWEERQEEDNLLIERILLLVRNILHVPADLDQEKKIDDDASAHDQLLWAIHLSGLDDLLLFLASSSA    141 - 210
EEQWSLHVLEIVSLMFRDQNPEQLAGVGQGRLAQERSADFAELEVLRQREMAEKKTRALQRGNRHSRFGG    211 - 280
SYIVQGLKSIGERDLIFHKGLHNLRNYSSDLGKQPKKVPKRRQAARELSIQRRSALNVRLFLRDFCSEFL    281 - 350
ENCYNRLMGSVKDHLLREKAQQHDETYYMWALAFFMAFNRAASFRPGLVSETLSVRTFHFIEQNLTNYYE    351 - 420
MMLTDRKEAASWARRMHLALKAYQELLATVNEMDISPDEAVRESSRIIKNNIFYVMEYRELFLALFRKFD    421 - 490
ERCQPRSFLRDLVETTHLFLKMLERFCRSRGNLVVQNKQKKRRKKKKKVLDQAIVSGNVPSSPEEVEAVW    491 - 560
PALAEQLQCCAQNSELSMDSVVPFDAASEVPVEEQRAEAMVRIQDCLLAGQAPQALTLLRSAREVWPEGD    561 - 630
VFGSQDISPEEEIQLLKQILSAPLPRQQGPEERGAEEEEEEEEEEEEELQVVQVSEKEFNFLDYLKRFAC    631 - 700
STVVRAYVLLLRSYQQNSAHTNHCIVKMLHRLAHDLKMEALLFQLSVFCLFNRLLSDPAAGAYKELVTFA    701 - 770
KYILGKFFALAAVNQKAFVELLFWKNTAVVREMTEGYGSLDDRSSSRRAPTWSPEEEAHLRELYLANKDV    771 - 840
EGQDVVEAILAHLNTVPRTRKQIIHHLVQMGLADSVKDFQRKGTHIVLWTGDQELELQRLFEEFRDSDDV    841 - 910
LGHIMKNITAKRSRARIVDKLLALGLVAERRELYKKRQKKLASSILPNGAESLKDFCQEDLEEEENLPEE    911 - 980
DSEEEEEGGSEAEQVQGSLVLSNENLGQSLHQEGFSIPLLWLQNCLIRAADDREEDGCSQAVPLVPLTEE    981 - 1050
NEEAMENEQFQQLLRKLGVRPPASGQETFWRIPAKLSPTQLRRAAASLSQPEEEQKLQPELQPKVPGEQG   1051 - 1120
SDEEHCKEHRAQALRALLLAHKKKAGLASPEEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELG   1121 - 1190
APGIQKKKRYQIEDDEDD                                                       1191 - 1208
//

Text Mined References (76)

PMID Year Title