Property Summary

NCBI Gene PubMed Count 60
Grant Count 259
R01 Count 140
Funding $32,231,792.33
PubMed Score 550.71
PubTator Score 56.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
glioblastoma 2.100 0.000
osteosarcoma -1.192 0.034
group 3 medulloblastoma 3.400 0.000
atypical teratoid / rhabdoid tumor 2.400 0.000
medulloblastoma, large-cell 2.700 0.000
primitive neuroectodermal tumor 2.600 0.000
Atopic dermatitis 1.200 0.000
adrenocortical carcinoma 1.651 0.000
tuberculosis 1.200 0.000
non-small cell lung cancer 2.034 0.000
lung cancer 3.400 0.000
colon cancer 1.400 0.002
pediatric high grade glioma 1.700 0.000
lung adenocarcinoma 1.500 0.000
nasopharyngeal carcinoma 1.200 0.000
psoriasis 1.100 0.000
inflammatory breast cancer 1.500 0.000
breast carcinoma 1.100 0.000
ductal carcinoma in situ 1.100 0.001
invasive ductal carcinoma 1.500 0.000
ovarian cancer 1.500 0.000

Synonym

Accession Q9UNS1 B2ZAV0 O94802 Q86VM1 Q8IWH3 hTIM
Symbols TIM
TIM1
hTIM

Gene

PDB

4XHT   4XHU   4XHW  

Gene RIF (45)

PMID Text
26456830 TIMELESS mutants unable to bind PARP1. TIMELESS silencing significantly impairs DNA double-strand break repair.
26344098 Data reports the crystal structure of Timeless-PARP-1 complex and provides evidence that Timeless is recruited to sites of DNA damage through PARP-1 to mediate homologous recombination repair of DNA double-strand breaks.
25405317 overexpression of TIM exerts oncogenic function in human HCCs, which is mediated via CHEK2 and EEF1A2.
24716566 TIMELESS and RORA genes may confer susceptibility to bipolar disorders and impact on circadian phenotypes
24636202 The results of this study suggest that the TIMELESS gene may be associated with the lithium prophylactic response in bipolar illness.
24161199 TIMELESS is frequently overexpressed in various types of tumor tissues, and elevated TIMELESS expression is associated with advanced tumor stage and poorer breast cancer prognosis.
23511638 Tim-Tipin complex (or Tim alone) is able to associate with DNA polymerase epsilon bound to a 40-/80-mer DNA ligand.
23418588 Data indicate that RNAi-mediated knockdown of TIMELESS (TIM) in NIH3T3 and U2OS cells shortens the period by 1 hour and diminishes DNA damage-dependent phase advancing.
23325691 Kaposi's Sarcoma-associated herpesvirus episome maintenance requires Tim-assisted replication fork protection at the viral terminal repeats.
23255133 TIMELESS has a distinct contribution to suppression of chromosomal instability that is independent of its heterodimeric partner, TIPIN.
More...

AA Sequence

MDLHMMNCELLATCSALGYLEGDTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQILQSDLLPILT      1 - 70
QHHQDKPLFDAVIRLMVNLTQPALLCFGNLPKEPSFRHHFLQVLTYLQAYKEAFASEKAFGVLSETLYEL     71 - 140
LQLGWEERQEEDNLLIERILLLVRNILHVPADLDQEKKIDDDASAHDQLLWAIHLSGLDDLLLFLASSSA    141 - 210
EEQWSLHVLEIVSLMFRDQNPEQLAGVGQGRLAQERSADFAELEVLRQREMAEKKTRALQRGNRHSRFGG    211 - 280
SYIVQGLKSIGERDLIFHKGLHNLRNYSSDLGKQPKKVPKRRQAARELSIQRRSALNVRLFLRDFCSEFL    281 - 350
ENCYNRLMGSVKDHLLREKAQQHDETYYMWALAFFMAFNRAASFRPGLVSETLSVRTFHFIEQNLTNYYE    351 - 420
MMLTDRKEAASWARRMHLALKAYQELLATVNEMDISPDEAVRESSRIIKNNIFYVMEYRELFLALFRKFD    421 - 490
ERCQPRSFLRDLVETTHLFLKMLERFCRSRGNLVVQNKQKKRRKKKKKVLDQAIVSGNVPSSPEEVEAVW    491 - 560
PALAEQLQCCAQNSELSMDSVVPFDAASEVPVEEQRAEAMVRIQDCLLAGQAPQALTLLRSAREVWPEGD    561 - 630
VFGSQDISPEEEIQLLKQILSAPLPRQQGPEERGAEEEEEEEEEEEEELQVVQVSEKEFNFLDYLKRFAC    631 - 700
STVVRAYVLLLRSYQQNSAHTNHCIVKMLHRLAHDLKMEALLFQLSVFCLFNRLLSDPAAGAYKELVTFA    701 - 770
KYILGKFFALAAVNQKAFVELLFWKNTAVVREMTEGYGSLDDRSSSRRAPTWSPEEEAHLRELYLANKDV    771 - 840
EGQDVVEAILAHLNTVPRTRKQIIHHLVQMGLADSVKDFQRKGTHIVLWTGDQELELQRLFEEFRDSDDV    841 - 910
LGHIMKNITAKRSRARIVDKLLALGLVAERRELYKKRQKKLASSILPNGAESLKDFCQEDLEEEENLPEE    911 - 980
DSEEEEEGGSEAEQVQGSLVLSNENLGQSLHQEGFSIPLLWLQNCLIRAADDREEDGCSQAVPLVPLTEE    981 - 1050
NEEAMENEQFQQLLRKLGVRPPASGQETFWRIPAKLSPTQLRRAAASLSQPEEEQKLQPELQPKVPGEQG   1051 - 1120
SDEEHCKEHRAQALRALLLAHKKKAGLASPEEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELG   1121 - 1190
APGIQKKKRYQIEDDEDD                                                       1191 - 1208
//

Text Mined References (71)

PMID Year Title
26456830 2015 TIMELESS Forms a Complex with PARP1 Distinct from Its Complex with TIPIN and Plays a Role in the DNA Damage Response.
26344098 2015 Timeless Interacts with PARP-1 to Promote Homologous Recombination Repair.
25405317 2015 Protumorigenic role of Timeless in hepatocellular carcinoma.
24716566 2014 Association between circadian genes, bipolar disorders and chronotypes.
24636202 2014 Polymorphism of circadian clock genes and prophylactic lithium response.
24161199 2013 Potential cancer-related role of circadian gene TIMELESS suggested by expression profiling and in vitro analyses.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23797032 2013 Roles of ChlR1 DNA helicase in replication recovery from DNA damage.
23511638 2013 The human Tim-Tipin complex interacts directly with DNA polymerase epsilon and stimulates its synthetic activity.
23418588 2013 Mammalian TIMELESS is involved in period determination and DNA damage-dependent phase advancing of the circadian clock.
More...