Property Summary

NCBI Gene PubMed Count 19
PubMed Score 56.31
PubTator Score 16.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
group 3 medulloblastoma 2254 5.64035920823036E-4
lung cancer 4473 0.00112537956401123
primitive neuroectodermal tumor 3031 0.00203269332054557
glioblastoma 5572 0.00696698802935142
Multiple myeloma 1328 0.0343663595535819
Disease Target Count Z-score Confidence
Cancer 2346 3.195 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.091 0.034
glioblastoma 1.100 0.007
primitive neuroectodermal tumor 1.100 0.002
lung cancer 2.000 0.001
group 3 medulloblastoma 1.400 0.001

Synonym

Accession Q9UNI6 Q5VXA8
Symbols YVH1
DUSP1

Gene

PDB

4JNB   4KI9  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (11)

PMID Text
21556130 propose that the BRC repeats in BRCA2 cooperate in a partially redundant but reinforcing manner to ensure a high probability of RAD51 filament formation
21521943 hYVH1 is a novel modulator of cell cycle progression mediated by a phosphorylation site located at the C-terminal end of the zinc-binding domain
21211013 these data suggests common SNPs within DUSP12-ATF6 locus may not play a major role in glucose metabolism in the Chinese.
20103624 tudies confirmed elevated expression of three target antigens RAB38, TBCE, and DUSP12 in CML.
19567874 Data determined that hYVH1 forms intramolecular disulfide bonds at the catalytic cleft as well as within the zinc binding domain to avoid irreversible inactivation during severe oxidative stress.
19087671 Observational study of gene-disease association. (HuGE Navigator)
18973475 hYVH1 is a novel cell survival phosphatase that co-operates with Hsp70 to positively affect cell viability in response to cellular insults.
18854154 Knockdown of dual specificity phosphatase 12 (DUSP12) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18269685 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16936214 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLEAPGPSDGCELSNPSASRVSCAGQMLEVQPGLYFGGAAAVAEPDHLREAGITAVLTVDSEEPSFKAGP      1 - 70
GVEDLWRLFVPALDKPETDLLSHLDRCVAFIGQARAEGRAVLVHCHAGVSRSVAIITAFLMKTDQLPFEK     71 - 140
AYEKLQILKPEAKMNEGFEWQLKLYQAMGYEVDTSSAIYKQYRLQKVTEKYPELQNLPQELFAVDPTTVS    141 - 210
QGLKDEVLYKCRKCRRSLFRSSSILDHREGSGPIAFAHKRMTPSSMLTTGRQAQCTSYFIEPVQWMESAL    211 - 280
LGVMDGQLLCPKCSAKLGSFNWYGEQCSCGRWITPAFQIHKNRVDEMKILPVLGSQTGKI              281 - 340
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24531476 2014 The family-wide structure and function of human dual-specificity protein phosphatases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21556130 2011 Characterization of a human cell line stably over-expressing the candidate oncogene, dual specificity phosphatase 12.
21521943 2011 The dual-specificity phosphatase hYVH1 (DUSP12) is a novel modulator of cellular DNA content.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
21211013 2011 Lack of association between genetic polymorphisms within DUSP12 - ATF6 locus and glucose metabolism related traits in a Chinese population.
More...