Property Summary

NCBI Gene PubMed Count 21
PubMed Score 60.21
PubTator Score 16.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 4104 5.6e-04
lung cancer 4740 1.1e-03
primitive neuroectodermal tumor 3035 2.0e-03
glioblastoma 5792 7.0e-03
Multiple myeloma 1332 3.4e-02
Disease Target Count Z-score Confidence
Cancer 2499 3.277 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.100 7.0e-03
group 3 medulloblastoma 1.400 5.6e-04
lung cancer 2.000 1.1e-03
Multiple myeloma 1.091 3.4e-02
primitive neuroectodermal tumor 1.100 2.0e-03

Gene RIF (13)

AA Sequence

MLEAPGPSDGCELSNPSASRVSCAGQMLEVQPGLYFGGAAAVAEPDHLREAGITAVLTVDSEEPSFKAGP      1 - 70
GVEDLWRLFVPALDKPETDLLSHLDRCVAFIGQARAEGRAVLVHCHAGVSRSVAIITAFLMKTDQLPFEK     71 - 140
AYEKLQILKPEAKMNEGFEWQLKLYQAMGYEVDTSSAIYKQYRLQKVTEKYPELQNLPQELFAVDPTTVS    141 - 210
QGLKDEVLYKCRKCRRSLFRSSSILDHREGSGPIAFAHKRMTPSSMLTTGRQAQCTSYFIEPVQWMESAL    211 - 280
LGVMDGQLLCPKCSAKLGSFNWYGEQCSCGRWITPAFQIHKNRVDEMKILPVLGSQTGKI              281 - 340
//

Text Mined References (26)

PMID Year Title