Property Summary

NCBI Gene PubMed Count 20
Grant Count 5
R01 Count 4
Funding $384,610.4
PubMed Score 59.68
PubTator Score 28.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Duchenne muscular dystrophy 1.215 0.000
acute quadriplegic myopathy 1.038 0.000
diabetes mellitus -1.800 0.001
invasive ductal carcinoma 1.300 0.005
ovarian cancer -1.200 0.000
dermatomyositis 1.300 0.003

Gene RIF (10)

PMID Text
27120771 We found that MAGED2 mutations caused X-linked polyhydramnios with prematurity and a severe but transient form of antenatal Bartter's syndrome.
26705694 MAGE-D2 is a dynamic protein whose shuttling properties could suggest a role in cell cycle regulation.
25743330 Increased expression of MAGE-D2 mRNA was associated with distant metastasis in Gastric Cancer.
22791814 these results identify the expression of MAGE-D2 suppresses TRAIL receptor 2 and protects againstas TRAIL-induced apoptosis
20237496 Observational study of gene-disease association. (HuGE Navigator)
18095154 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17912449 MAGED2, a novel protein, is a p53-dissociator.
15465002 Results identified a cDNA clone, corresponding to MAGE D2 mRNA, from primary human bronchial epithelial cells which exhibits increased expression in vitro after treatment with all-trans retinoic acid.
15162511 Maged2 is mainly expressed in tissues of mesodermal origin
11856887 Expression pattern and further characterization of human MAGED2 and identification of rodent orthologues

AA Sequence

MSDTSESGAGLTRFQAEASEKDSSSMMQTLLTVTQNVEVPETPKASKALEVSEDVKVSKASGVSKATEVS      1 - 70
KTPEAREAPATQASSTTQLTDTQVLAAENKSLAADTKKQNADPQAVTMPATETKKVSHVADTKVNTKAQE     71 - 140
TEAAPSQAPADEPEPESAAAQSQENQDTRPKVKAKKARKVKHLDGEEDGSSDQSQASGTTGGRRVSKALM    141 - 210
ASMARRASRGPIAFWARRASRTRLAAWARRALLSLRSPKARRGKARRRAAKLQSSQEPEAPPPRDVALLQ    211 - 280
GRANDLVKYLLAKDQTKIPIKRSDMLKDIIKEYTDVYPEIIERAGYSLEKVFGIQLKEIDKNDHLYILLS    281 - 350
TLEPTDAGILGTTKDSPKLGLLMVLLSIIFMNGNRSSEAVIWEVLRKLGLRPGIHHSLFGDVKKLITDEF    351 - 420
VKQKYLDYARVPNSNPPEYEFFWGLRSYYETSKMKVLKFACKVQKKDPKEWAAQYREAMEADLKAAAEAA    421 - 490
AEAKARAEIRARMGIGLGSENAAGPCNWDEADIGPWAKARIQAGAEAKAKAQESGSASTGASTSTNNSAS    491 - 560
ASASTSGGFSAGASLTATLTFGLFAGLGGAGASTSGSSGACGFSYK                            561 - 606
//

Text Mined References (34)

PMID Year Title
27120771 2016 Polyhydramnios, Transient Antenatal Bartter's Syndrome, and MAGED2 Mutations.
26705694 2016 Melanoma antigen-D2: A nucleolar protein undergoing delocalization during cell cycle and after cellular stress.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25743330 2016 The Expression of Melanoma-Associated Antigen D2 Both in Surgically Resected and Serum Samples Serves as Clinically Relevant Biomarker of Gastric Cancer Progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22791814 2012 The melanoma-associated antigen MAGE-D2 suppresses TRAIL receptor 2 and protects against TRAIL-induced apoptosis in human melanoma cells.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...