Property Summary

NCBI Gene PubMed Count 20
PubMed Score 62.63
PubTator Score 28.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
BARTTER SYNDROME, TYPE 5, ANTENATAL, TRANSIENT 1 0.0 0.0
Disease Target Count
Bartter syndrome, antenatal type 1 3
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Bartter disease 13 3.761 1.9
Disease Target Count Z-score Confidence
Polyhydramnios 108 3.897 1.9
Cancer 2499 3.138 1.6
Disease Target Count
Bartter disease type 1 3

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.038 1.7e-06
dermatomyositis 1.300 2.6e-03
diabetes mellitus -1.800 1.2e-03
Duchenne muscular dystrophy 1.215 1.9e-11
invasive ductal carcinoma 1.300 5.0e-03
ovarian cancer -1.200 1.5e-04

Gene RIF (10)

AA Sequence

MSDTSESGAGLTRFQAEASEKDSSSMMQTLLTVTQNVEVPETPKASKALEVSEDVKVSKASGVSKATEVS      1 - 70
KTPEAREAPATQASSTTQLTDTQVLAAENKSLAADTKKQNADPQAVTMPATETKKVSHVADTKVNTKAQE     71 - 140
TEAAPSQAPADEPEPESAAAQSQENQDTRPKVKAKKARKVKHLDGEEDGSSDQSQASGTTGGRRVSKALM    141 - 210
ASMARRASRGPIAFWARRASRTRLAAWARRALLSLRSPKARRGKARRRAAKLQSSQEPEAPPPRDVALLQ    211 - 280
GRANDLVKYLLAKDQTKIPIKRSDMLKDIIKEYTDVYPEIIERAGYSLEKVFGIQLKEIDKNDHLYILLS    281 - 350
TLEPTDAGILGTTKDSPKLGLLMVLLSIIFMNGNRSSEAVIWEVLRKLGLRPGIHHSLFGDVKKLITDEF    351 - 420
VKQKYLDYARVPNSNPPEYEFFWGLRSYYETSKMKVLKFACKVQKKDPKEWAAQYREAMEADLKAAAEAA    421 - 490
AEAKARAEIRARMGIGLGSENAAGPCNWDEADIGPWAKARIQAGAEAKAKAQESGSASTGASTSTNNSAS    491 - 560
ASASTSGGFSAGASLTATLTFGLFAGLGGAGASTSGSSGACGFSYK                            561 - 606
//

Text Mined References (34)

PMID Year Title