Property Summary

NCBI Gene PubMed Count 18
PubMed Score 20.97
PubTator Score 15.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease 2.314 1.3e-02
active ulcerative colitis 2.432 3.3e-03
adult high grade glioma 1.200 5.9e-04
ductal carcinoma in situ 1.100 1.1e-02
intraductal papillary-mucinous adenoma (... 1.100 6.1e-03
intraductal papillary-mucinous neoplasm ... 1.100 2.1e-02
invasive ductal carcinoma 1.500 4.5e-03
lung carcinoma -2.200 4.4e-25
medulloblastoma, large-cell 1.100 8.3e-04
osteosarcoma -1.588 3.5e-02
ovarian cancer 1.400 2.7e-09
pancreatic cancer 1.400 2.2e-04
pancreatic ductal adenocarcinoma liver m... 1.035 6.7e-03
primary Sjogren syndrome 1.500 9.2e-04
psoriasis 1.200 5.1e-04
spina bifida -1.266 3.8e-02
subependymal giant cell astrocytoma 1.542 4.3e-03
urothelial carcinoma -1.400 3.9e-02

Protein-protein Interaction (4)

Gene RIF (3)

AA Sequence

MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLY      1 - 70
SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYE     71 - 140
SVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDL    141 - 210
TECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK    211 - 280
//

Text Mined References (19)

PMID Year Title