Property Summary

NCBI Gene PubMed Count 18
Grant Count 12
R01 Count 10
Funding $878,469.81
PubMed Score 20.04
PubTator Score 15.25

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
21930970 we propose a role for Bam32 in the signaling of MHC class I molecules in professional Ag-presenting DC for the regulation of CD8(+) T cell activation.
15494510 BAM32 works downstream of Src family protein tyrosine kinases and functions to link B cell antigen receptor signals with antigen-processing pathways in B cells.
15247305 novel phosphorylation-dependent function of Bam32 in regulating Rac1 activation and actin remodeling.

AA Sequence

MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLY      1 - 70
SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYE     71 - 140
SVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDL    141 - 210
TECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK    211 - 280
//

Text Mined References (19)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
21930970 2011 The adaptor protein Bam32 in human dendritic cells participates in the regulation of MHC class I-induced CD8+ T cell activation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17823121 2007 Mechanistic basis of differential cellular responses of phosphatidylinositol 3,4-bisphosphate- and phosphatidylinositol 3,4,5-trisphosphate-binding pleckstrin homology domains.
15494510 2004 The B lymphocyte adaptor molecule of 32 kilodaltons (Bam32) regulates B cell antigen receptor internalization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15247305 2004 The adaptor protein Bam32 regulates Rac1 activation and actin remodeling through a phosphorylation-dependent mechanism.
14563325 2003 Bam32 links the B cell receptor to ERK and JNK and mediates B cell proliferation but not survival.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12101241 2002 TAPP1 and TAPP2 are targets of phosphatidylinositol 3-kinase signaling in B cells: sustained plasma membrane recruitment triggered by the B-cell antigen receptor.
More...