Property Summary

NCBI Gene PubMed Count 18
PubMed Score 13.05
PubTator Score 7.43

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
active Crohn's disease 1.100 3.4e-02
chronic lymphosyte leukemia 1.500 2.5e-08
cutaneous lupus erythematosus 1.100 2.9e-02
group 3 medulloblastoma 1.200 1.8e-02
interstitial cystitis 1.100 2.7e-05
lung cancer 1.200 3.0e-03
posterior fossa group B ependymoma 1.300 5.7e-06

Protein-protein Interaction (1)

Gene RIF (3)

AA Sequence

MASNERDAISWYQKKIGAYDQQIWEKSIEQTQIKGLKNKPKKMGHIKPDLIDVDLIRGSTFAKAKPEIPW      1 - 70
TSLTRKGLVRVVFFPLFSNWWIQVTSLRIFVWLLLLYFMQVIAIVLYLMMPIVNISEVLGPLCLMLLMGT     71 - 140
VHCQIVSTQITRPSGNNGNRRRRKLRKTVNGDGSRENGNNSSDKVRGIETLESVPIIGGFWETIFGNRIK    141 - 210
RVKLISNKGTETDNDPSCVHPIIKRRQCRPEIRMWQTREKAKFSDGEKCRREAFRRLGNGVSDDLSSEED    211 - 280
GEARTQMILLRRSVEGASSDNGCEVKNRKSILSRHLNSQVKKTTTRWCHIVRDSDSLAESEFESAAFSQG    281 - 350
SRSGVSGGSRSLNMSRRDSESTRHDSETEDMLWDDLLHGPECRSSVTSDSEGAHVNTLHSGTKRDPKEDV    351 - 420
FQQNHLFWLQNSSPSSDRVSAIIWEGNECKKMDMSVLEISGIIMSRVNAYQQGVGYQMLGNVVTIGLAFF    421 - 490
PFLHRLFREKSLDQLKSISAEEILTLFCGAPPVTPIIVLSIINFFERLCLTWMFFFMMCVAERTYKQRFL    491 - 560
FAKLFSHITSARKARKYEIPHFRLKKVENIKIWLSLRSYLKRRGPQRSVDVVVSSVFLLTLSIAFICCAQ    561 - 630
VLQGHKTFLNDAYNWEFLIWETALLLFLLRLASLGSETNKKYSNVSILLTEQINLYLKMEKKPNKKEQLT    631 - 700
LVNNVLKLSTKLLKELDTPFRLYGLTMNPLIYNITRVVILSAVSGVISDLLGFNIRLWKIKS            701 - 762
//

Text Mined References (18)

PMID Year Title