Property Summary

NCBI Gene PubMed Count 23
PubMed Score 72.65
PubTator Score 21.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
invasive ductal carcinoma -1.100 2.6e-03
Multiple myeloma 1.353 3.9e-03
ovarian cancer -1.400 5.4e-05

Gene RIF (16)

AA Sequence

MAATARRGWGAAAVAAGLRRRFCHMLKNPYTIKKQPLHQFVQRPLFPLPAAFYHPVRYMFIQTQDTPNPN      1 - 70
SLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYAT     71 - 140
IMDFFASGLPLVTEETPSGEAGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSC    141 - 210
TSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDESDEKEANSP                              211 - 254
//

Text Mined References (32)

PMID Year Title