Property Summary

NCBI Gene PubMed Count 21
Grant Count 17
R01 Count 5
Funding $1,494,419
PubMed Score 47.04
PubTator Score 38.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (19)

PMID Text
26429306 DCIR SNP rs2377422 is a novel genetic susceptibility factor for both SLE and primary SS.
26018157 HIV-1 Env gp120/41 (JRFL Env in the contaxt of HIV-Gag-GFP VLP) binds to CLEC4A (DCIR) on the surface of basophils
25407434 HIV-1 Env gp120/41 (JRFL Env in the contaxt of HIV-Gag-GFP VLP) binds to CLEC4A (DCIR) on the surface of basophils
24928041 HIV-1 Env gp120/41 (JRFL Env in the contaxt of HIV-Gag-GFP VLP) binds to CLEC4A (DCIR) on the surface of basophils
24928041 HIV-1 Env gp120/41 (JRFL Env in the contaxt of HIV-Gag-GFP VLP) binds to CLEC4A (DCIR) on the surface of basophils
24239607 this study shows that sulfo-Lewis(a) is a high affinity ligand for DCIR and that DCIR interacts with ligands from both pathogenic and endogenous origin of which most are shared by DC-SIGN.
24239607 HIV-1 Env gp120/41 (JRFL Env in the contaxt of HIV-Gag-GFP VLP) binds to CLEC4A (DCIR) on the surface of basophils
24239607 HIV-1 Env gp120/41 (JRFL Env in the contaxt of HIV-Gag-GFP VLP) binds to CLEC4A (DCIR) on the surface of basophils
22829930 Data provide evidence for association between DCIR rs2377422 and RA in non-Caucasian populations and confirm the influence of DCIR polymorphisms on RA susceptibility, especially on ACPA-negative RA.
22664939 No association was found between our inflammatory bowel disease cohort and the candidate single nucleotide polymorphisms for DCIR (CD/HC: P=0.22 and UC/HC: P=0.41)
More...

AA Sequence

MTSEITYAEVRFKNEFKSSGINTASSAASKERTAPHKSNTGFPKLLCASLLIFFLLLAISFFIAFVIFFQ      1 - 70
KYSQLLEKKTTKELVHTTLECVKKNMPVEETAWSCCPKNWKSFSSNCYFISTESASWQDSEKDCARMEAH     71 - 140
LLVINTQEEQDFIFQNLQEESAYFVGLSDPEGQRHWQWVDQTPYNESSTFWHPREPSDPNERCVVLNFRK    141 - 210
SPKRWGWNDVNCLGPQRSVCEMMKIHL                                               211 - 237
//

Text Mined References (22)

PMID Year Title
26429306 2015 Contribution of dendritic cell immunoreceptor (DCIR) polymorphisms in susceptibility of systemic lupus erythematosus and primary Sjogren's syndrome.
24239607 DCIR interacts with ligands from both endogenous and pathogenic origin.
22829930 2012 A replication study confirms the association of dendritic cell immunoreceptor (DCIR) polymorphisms with ACPA - negative RA in a large Asian cohort.
22664939 2012 Single nucleotide polymorphisms in C-type lectin genes, clustered in the IBD2 and IBD6 susceptibility loci, may play a role in the pathogenesis of inflammatory bowel diseases.
21536857 2011 DCIR-mediated enhancement of HIV-1 infection requires the ITIM-associated signal transduction pathway.
20530286 2010 Cross-priming CD8+ T cells by targeting antigens to human dendritic cells through DCIR.
19028959 2009 DCIR is endocytosed into human dendritic cells and inhibits TLR8-mediated cytokine production.
18541725 2008 The C-type lectin surface receptor DCIR acts as a new attachment factor for HIV-1 in dendritic cells and contributes to trans- and cis-infection pathways.
18480830 2008 Differential expression of transcripts for the autoimmunity-related human dendritic cell immunoreceptor.
18258799 2008 Targeting DCIR on human plasmacytoid dendritic cells results in antigen presentation and inhibits IFN-alpha production.
More...