Property Summary

NCBI Gene PubMed Count 33
PubMed Score 67.28
PubTator Score 55.54

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.300 1.1e-03
astrocytic glioma -1.400 5.1e-03
Astrocytoma, Pilocytic -2.200 1.3e-05
atypical teratoid / rhabdoid tumor -2.300 4.8e-07
ependymoma -1.800 5.5e-03
glioblastoma -1.700 5.2e-06
group 4 medulloblastoma -1.800 8.9e-03
medulloblastoma, large-cell -2.500 1.1e-03
oligodendroglioma -1.300 2.4e-02
primitive neuroectodermal tumor -2.400 5.7e-04

Gene RIF (18)

AA Sequence

MPGPSPGLRRALLGLWAALGLGLFGLSAVSQEPFWADLQPRVAFVERGGSLWLNCSTNCPRPERGGLETS      1 - 70
LRRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRPDRVELMPLPPWQPVGENFTL     71 - 140
SCRVPGAGPRASLTLTLLRGAQELIRRSFAGEPPRARGAVLTATVLARREDHGANFSCRAELDLRPHGLG    141 - 210
LFENSSAPRELRTFSLSPDAPRLAAPRLLEVGSERPVSCTLDGLFPASEARVYLALGDQNLSPDVTLEGD    211 - 280
AFVATATATASAEQEGARQLVCNVTLGGENRETRENVTIYSFPAPLLTLSEPSVSEGQMVTVTCAAGAQA    281 - 350
LVTLEGVPAAVPGQPAQLQLNATENDDRRSFFCDATLDVDGETLIKNRSAELRVLYAPRLDDSDCPRSWT    351 - 420
WPEGPEQTLRCEARGNPEPSVHCARSDGGAVLALGLLGPVTRALSGTYRCKAANDQGEAVKDVTLTVEYA    421 - 490
PALDSVGCPERITWLEGTEASLSCVAHGVPPPDVICVRSGELGAVIEGLLRVAREHAGTYRCEATNPRGS    491 - 560
AAKNVAVTVEYGPRFEEPSCPSNWTWVEGSGRLFSCEVDGKPQPSVKCVGSGGATEGVLLPLAPPDPSPR    561 - 630
APRIPRVLAPGIYVCNATNRHGSVAKTVVVSAESPPEMDESTCPSHQTWLEGAEASALACAARGRPSPGV    631 - 700
RCSREGIPWPEQQRVSREDAGTYHCVATNAHGTDSRTVTVGVEYRPVVAELAASPPGGVRPGGNFTLTCR    701 - 770
AEAWPPAQISWRAPPGALNIGLSSNNSTLSVAGAMGSHGGEYECAATNAHGRHARRITVRVAGPWLWVAV    771 - 840
GGAAGGAALLAAGAGLAFYVQSTACKKGEYNVQEAESSGEAVCLNGAGGGAGGAAGAEGGPEAAGGAAES    841 - 910
PAEGEVFAIQLTSA                                                            911 - 924
//

Text Mined References (36)

PMID Year Title