Property Summary

NCBI Gene PubMed Count 74
Grant Count 18
R01 Count 8
Funding $3,622,882.97
PubMed Score 111.02
PubTator Score 155.60

Knowledge Summary

Patent

No data available

Expression

Gene RIF (42)

PMID Text
26851016 High PLAGL1 mRNA and protein levels were associated with Clear Cell Renal Cell Carcinoma.
26134521 Results suggest that dysregulation of PLAGL1 expression may be involved in the progression of colorectal cancer (CRC) but the patient survival data do not confirm applicability of the PLAGL1 expression level as a prognostic factor in CRC.
25091631 DNA deletion and promoter hyper-methylation both contribute to the down-regulation of PLAGL1 in gastric adenocarcinoma
24993786 Fetal growth can be influenced by altered expression of the PLAGL1 gene network in human placenta.
24316753 There is positive correlations between the ZAC1 DMR methylation index (MI) and estimated fetal weight (EFW) at 32 weeks of gestation, weight at birth and weight at one year of age (respectively, r = 0.15, 0.09, 0.14; P values = 0.01, 0.15, 0.03).
24260468 research identified a specific CpG site where determination of the methylation status was associated with both metastasis-free and overall survival in undifferentiated sarcoma.
24098585 ZAC1 and SSTR2 are down-regulated in non-functioning pituitary adenomas but not in somatotropinomas.
23415968 Paternal methylation aberrations at imprinting control regions of DLK1-GTL2, MEST (PEG1), and ZAC (PLAGL1) and global methylation levels are not associated with idiopathic recurrent spontaneous miscarriages.
23333304 HIV-1 Vif downregulates the expression of pleiomorphic adenoma gene-like 1 (PLAGL1) in Vif-expression T cells
23295672 The imprinted PLAGL1 domain is flanked by CTCF-binding sites conserved between species in both expressing and non-expressing cells.
More...

AA Sequence

MATFPCQLCGKTFLTLEKFTIHNYSHSRERPYKCVQPDCGKAFVSRYKLMRHMATHSPQKSHQCAHCEKT      1 - 70
FNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLGYKRHLALHAASSGDLTCGVCALELGSTEVLLDHLK     71 - 140
AHAEEKPPSGTKEKKHQCDHCERCFYTRKDVRRHLVVHTGCKDFLCQFCAQRFGRKDHLTRHTKKTHSQE    141 - 210
LMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPE    211 - 280
SLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFD    281 - 350
LAKGNAGKVNLPKELPADAVNLTIPASLDLSPLLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQ    351 - 420
QQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR                               421 - 463
//

Text Mined References (76)

PMID Year Title
26851016 2016 PLAGL1 (ZAC1/LOT1) Expression in Clear Cell Renal Cell Carcinoma: Correlations with Disease Progression and Unfavorable Prognosis.
26134521 2015 Altered expression of the PLAGL1 (ZAC1/LOT1) gene in colorectal cancer: Correlations to the clinicopathological parameters.
25091631 2014 Both gene deletion and promoter hyper-methylation contribute to the down-regulation of ZAC/PLAGL1 gene in gastric adenocarcinomas: a case control study.
24993786 2014 Altered expression of the imprinted transcription factor PLAGL1 deregulates a network of genes in the human IUGR placenta.
24316753 2014 Degree of methylation of ZAC1 (PLAGL1) is associated with prenatal and post-natal growth in healthy infants of the EDEN mother child cohort.
24260468 2013 Prognostic value of PLAGL1-specific CpG site methylation in soft-tissue sarcomas.
24098585 2013 ZAC1 and SSTR2 are downregulated in non-functioning pituitary adenomas but not in somatotropinomas.
23630160 2013 Zac1 regulates astroglial differentiation of neural stem cells through Socs3.
23415968 2013 Methylation status of imprinted genes DLK1-GTL2, MEST (PEG1), ZAC (PLAGL1), and LINE-1 elements in spermatozoa of normozoospermic men, unlike H19 imprinting control regions, is not associated with idiopathic recurrent spontaneous miscarriages.
23295672 2013 Imprinting at the PLAGL1 domain is contained within a 70-kb CTCF/cohesin-mediated non-allelic chromatin loop.
More...