Property Summary

NCBI Gene PubMed Count 78
PubMed Score 117.15
PubTator Score 155.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Diabetes Mellitus, Transient Neonatal, 1 4 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (24)

Disease log2 FC p
active ulcerative colitis -1.253 3.6e-02
aldosterone-producing adenoma -1.402 1.8e-02
atypical teratoid / rhabdoid tumor 2.000 4.7e-03
autosomal dominant Emery-Dreifuss muscul... 1.412 6.2e-03
Breast cancer -2.900 7.1e-12
breast carcinoma -1.500 3.2e-05
colon cancer -1.900 3.2e-02
dermatomyositis 1.200 3.7e-03
Duchenne muscular dystrophy 1.501 6.1e-06
ductal carcinoma in situ -1.600 1.1e-03
glioblastoma -1.200 2.2e-02
intraductal papillary-mucinous adenoma (... -1.400 1.9e-02
intraductal papillary-mucinous neoplasm ... -2.100 2.8e-02
invasive ductal carcinoma -1.753 4.1e-05
juvenile dermatomyositis 1.670 1.7e-10
lung cancer -1.500 2.8e-03
lung carcinoma -2.400 4.5e-40
malignant mesothelioma -4.500 3.5e-08
non-small cell lung cancer -1.251 9.2e-12
ovarian cancer -3.100 5.1e-05
Pick disease 1.100 7.1e-04
pituitary cancer -5.000 6.2e-11
Polycystic ovary syndrome 1.050 1.3e-02
spina bifida -1.569 1.6e-02

Gene RIF (46)

AA Sequence

MATFPCQLCGKTFLTLEKFTIHNYSHSRERPYKCVQPDCGKAFVSRYKLMRHMATHSPQKSHQCAHCEKT      1 - 70
FNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLGYKRHLALHAASSGDLTCGVCALELGSTEVLLDHLK     71 - 140
AHAEEKPPSGTKEKKHQCDHCERCFYTRKDVRRHLVVHTGCKDFLCQFCAQRFGRKDHLTRHTKKTHSQE    141 - 210
LMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPE    211 - 280
SLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFD    281 - 350
LAKGNAGKVNLPKELPADAVNLTIPASLDLSPLLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQ    351 - 420
QQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR                               421 - 463
//

Text Mined References (80)

PMID Year Title