Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.34
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer -2.500 0.000
lung carcinoma -1.400 0.000
ulcerative colitis -1.600 0.001

Gene RIF (4)

PMID Text
25549724 The HHLA2 pathway represents a novel immunosuppressive mechanism within the tumor microenvironment.
25519928 Low B7-H5 expression is associated with pancreatic adenocarcinomas.
23784006 B7 homologue 5 (B7-H5), was identified as a specific ligand for CD28H
23716685 Data indicate that HHLA2 protein was predominantly found on cell membranes with some in the cytoplasm.

AA Sequence

MKAQTALSFFLILITSLSGSQGIFPLAFFIYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYK      1 - 70
VHSYYKGSDHLESQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYTCYVGTAIQVITNKVVLKVGV     71 - 140
FLTPVMKYEKRNTNSFLICSVLSVYPRPIITWKMDNTPISENNMEETGSLDSFSINSPLNITGSNSSYEC    141 - 210
TIENSLLKQTWTGRWTMKDGLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSRMKSGTFSVLAYYLSSSQN    211 - 280
TIINESRFSWNKELINQSDFSMNLMDLNLSDSGEYLCNISSDEYTLLTIHTVHVEPSQETASHNKGLWIL    281 - 350
VPSAILAAFLLIWSVKCCRAQLEARRSRHPADGAQQERCCVPPGERCPSAPDNGEENVPLSGKV          351 - 414
//

Text Mined References (12)

PMID Year Title
25549724 2015 Expression, Clinical Significance, and Receptor Identification of the Newest B7 Family Member HHLA2 Protein.
25519928 2015 Expression of the Novel Costimulatory Molecule B7-H5 in Pancreatic Cancer.
23784006 2013 B7-H5 costimulates human T cells via CD28H.
23716685 2013 HHLA2 is a member of the B7 family and inhibits human CD4 and CD8 T-cell function.
22488247 2012 Evolution of the B7 family: co-evolution of B7H6 and NKp30, identification of a new B7 family member, B7H7, and of B7's historical relationship with the MHC.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...