Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.39
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 2.6e-04
colon cancer 1478 3.5e-04
ulcerative colitis 1819 9.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer -2.500 3.5e-04
lung carcinoma -1.400 2.6e-04
ulcerative colitis -1.600 9.5e-04

Gene RIF (4)

AA Sequence

MKAQTALSFFLILITSLSGSQGIFPLAFFIYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYK      1 - 70
VHSYYKGSDHLESQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYTCYVGTAIQVITNKVVLKVGV     71 - 140
FLTPVMKYEKRNTNSFLICSVLSVYPRPIITWKMDNTPISENNMEETGSLDSFSINSPLNITGSNSSYEC    141 - 210
TIENSLLKQTWTGRWTMKDGLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSRMKSGTFSVLAYYLSSSQN    211 - 280
TIINESRFSWNKELINQSDFSMNLMDLNLSDSGEYLCNISSDEYTLLTIHTVHVEPSQETASHNKGLWIL    281 - 350
VPSAILAAFLLIWSVKCCRAQLEARRSRHPADGAQQERCCVPPGERCPSAPDNGEENVPLSGKV          351 - 414
//

Text Mined References (12)

PMID Year Title