Property Summary

NCBI Gene PubMed Count 58
PubMed Score 63.25
PubTator Score 10.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Polyploidy 4 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 2.3e-07
psoriasis 6694 1.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Asbestosis 20 3.57 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.997 2.3e-07
psoriasis -1.500 1.5e-04

Gene RIF (23)

AA Sequence

MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKS      1 - 70
PSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEKKGLFTYSLSTKRSSPD     71 - 140
DGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVY    141 - 210
LWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWN    211 - 280
AEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQ    281 - 350
YTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGY    351 - 420
SQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKVKWESVSVLN    421 - 490
LFTRIR                                                                    491 - 496
//

Text Mined References (65)

PMID Year Title