Property Summary

NCBI Gene PubMed Count 27
PubMed Score 23.22
PubTator Score 11.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active ulcerative colitis 1.112 3.8e-02
adult high grade glioma -1.800 2.0e-03
astrocytic glioma 1.100 2.8e-02
Astrocytoma, Pilocytic -1.200 7.5e-03
atypical teratoid / rhabdoid tumor -4.300 2.1e-09
ependymoma -3.200 2.0e-10
glioblastoma -2.100 1.5e-03
group 3 medulloblastoma 2.000 1.0e-02
intraductal papillary-mucinous neoplasm ... -1.100 2.9e-02
lung carcinoma 4.300 6.5e-39
medulloblastoma, large-cell 1.600 6.0e-04
oligodendroglioma 1.700 1.2e-02
Pick disease -2.400 1.7e-03
primitive neuroectodermal tumor -2.200 2.1e-02
progressive supranuclear palsy 1.600 6.5e-03
psoriasis -1.400 5.6e-26
subependymal giant cell astrocytoma -3.429 7.4e-03

Gene RIF (7)

AA Sequence

MLDPSSSEEESDEIVEEESGKEVLGSAPSGARLSPSRTSEGSAGSAGLGGGGAGAGAGVGAGGGGGSGAS      1 - 70
SGGGAGGLQPSSRAGGGRPSSPSPSVVSEKEKEELERLQKEEEERKKRLQLYVFVMRCIAYPFNAKQPTD     71 - 140
MARRQQKISKQQLQTVKDRFQAFLNGETQIMADEAFMNAVQSYYEVFLKSDRVARMVQSGGCSANDSREV    141 - 210
FKKHIEKRVRSLPEIDGLSKETVLSSWMAKFDAIYRGEEDPRKQQARMTASAASELILSKEQLYEMFQNI    211 - 280
LGIKKFEHQLLYNACQLDNPDEQAAQIRRELDGRLQMADQIARERKFPKFVSKEMENMYIEELKSSVNLL    281 - 350
MANLESMPVSKGGEFKLQKLKRSHNASIIDMGEESENQLSKSDVVLSFSLEVVIMEVQGLKSLAPNRIVY    351 - 420
CTMEVEGGEKLQTDQAEASKPTWGTQGDFSTTHALPAVKVKLFTESTGVLALEDKELGRVILHPTPNSPK    421 - 490
QSEWHKMTVSKNCPDQDLKIKLAVRMDKPQNMKHSGYLWAIGKNVWKRWKKRFFVLVQVSQYTFAMCSYR    491 - 560
EKKAEPQELLQLDGYTVDYTDPQPGLEGGRAFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSHKPV    561 - 630
PPTQVQKLNAKGGNVPQLDAPISQFYADRAQKHGMDEFISSNPCNFDHASLFEMVQRLTLDHRLNDSYSC    631 - 700
LGWFSPGQVFVLDEYCARNGVRGCHRHLCYLRDLLERAENGAMIDPTLLHYSFAFCASHVHGNRPDGIGT    701 - 770
VTVEEKERFEEIKERLRVLLENQITHFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPQEEVKTVIRK    771 - 840
CLEQAALVNYSRLSEYAKIEENQKDAENVGRLITPAKKLEDTIRLAELVIEVLQQNEEHHAEPHVDKGEA    841 - 910
FAWWSDLMVEHAETFLSLFAVDMDAALEVQPPDTWDSFPLFQLLNDFLRTDYNLCNGKFHKHLQDLFAPL    911 - 980
VVRYVDLMESSIAQSIHRGFERESWEPVKSLTSNLPNVNLPNVNLPKVPNLPVNIPLGIPQMPTFSAPSW    981 - 1050
MAAIYDADNGSGTSEDLFWKLDALQTFIRDLHWPEEEFGKHLEQRLKLMASDMIESCVKRTRIAFEVKLQ   1051 - 1120
KTSRSTDFRVPQSICTMFNVMVDAKAQSTKLCSMEMGQEHQYHSKIDELIEETVKEMITLLVAKFVTILE   1121 - 1190
GVLAKLSRYDEGTLFSSFLSFTVKAASKYVDVPKPGMDVADAYVTFVRHSQDVLRDKVNEEMYIERLFDQ   1191 - 1260
WYNSSMNVICTWLTDRMDLQLHIYQLKTLIRMVKKTYRDFRLQGVLDSTLNSKTYETIRNRLTVEEATAS   1261 - 1330
VSEGGGLQGISMKDSDEEDEEDD                                                  1331 - 1353
//

Text Mined References (29)

PMID Year Title