Property Summary

NCBI Gene PubMed Count 27
PubMed Score 22.86
PubTator Score 11.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count P-value
lung carcinoma 2844 6.51829267061973E-39
psoriasis 6685 5.59730474696595E-26
posterior fossa group B ependymoma 1530 8.65561726288147E-11
atypical teratoid / rhabdoid tumor 4369 2.14935401410513E-9
medulloblastoma, large-cell 6234 6.04127987479903E-4
group 3 medulloblastoma 2254 9.32019525759559E-4
adult high grade glioma 2148 0.00196002068368296
glioblastoma 5572 0.00436172047064061
Pick disease 1893 0.00475272033634703
astrocytic glioma 2241 0.00570851328298096
progressive supranuclear palsy 674 0.0064522793436667
subependymal giant cell astrocytoma 2287 0.00742149963160195
pilocytic astrocytoma 3086 0.0113576747730893
oligodendroglioma 2849 0.0118560148035242
primitive neuroectodermal tumor 3031 0.0205989984095099
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0286893111402346
active ulcerative colitis 477 0.0382113290752314
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Breast cancer 3099 0.0 1.0
Type 2 diabetes mellitus 192 0.0 1.0
Disease Target Count Z-score Confidence
Pineoblastoma 7 3.605 1.8
Angiodysplasia 5 3.445 1.7
Childhood medulloblastoma 5 3.396 1.7

Expression

Synonym

Accession Q9ULU8 A6NF60 Q13339 Q6GQQ6 Q8N2Z5 Q8N3M7 Q8NFR0 Q96BC2
Symbols CAPS
CAPS1
CADPS1
UNC-31

Gene

PANTHER Protein Class (1)

PDB

1WI1  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA EggNOG
Fruitfly OMA EggNOG

Gene RIF (7)

PMID Text
23801330 the preferential binding of CAPS1 to open syntaxin-1 can contribute to the stabilization of the open state of syntaxin-1 during its transition from "closed" state to the SNARE complex formation.
21798848 Loss of CADPS is associated with central nervous system primitive neuroectodermal tumor.
21601610 Increased level of CADPS protein, human in Schizophrenic patients
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15857609 Regulation of dense core vesicle release from PC12 cells by interaction between the D2 dopamine receptor and calcium-dependent activator protein for secretion (CAPS).

AA Sequence

MLDPSSSEEESDEIVEEESGKEVLGSAPSGARLSPSRTSEGSAGSAGLGGGGAGAGAGVGAGGGGGSGAS      1 - 70
SGGGAGGLQPSSRAGGGRPSSPSPSVVSEKEKEELERLQKEEEERKKRLQLYVFVMRCIAYPFNAKQPTD     71 - 140
MARRQQKISKQQLQTVKDRFQAFLNGETQIMADEAFMNAVQSYYEVFLKSDRVARMVQSGGCSANDSREV    141 - 210
FKKHIEKRVRSLPEIDGLSKETVLSSWMAKFDAIYRGEEDPRKQQARMTASAASELILSKEQLYEMFQNI    211 - 280
LGIKKFEHQLLYNACQLDNPDEQAAQIRRELDGRLQMADQIARERKFPKFVSKEMENMYIEELKSSVNLL    281 - 350
MANLESMPVSKGGEFKLQKLKRSHNASIIDMGEESENQLSKSDVVLSFSLEVVIMEVQGLKSLAPNRIVY    351 - 420
CTMEVEGGEKLQTDQAEASKPTWGTQGDFSTTHALPAVKVKLFTESTGVLALEDKELGRVILHPTPNSPK    421 - 490
QSEWHKMTVSKNCPDQDLKIKLAVRMDKPQNMKHSGYLWAIGKNVWKRWKKRFFVLVQVSQYTFAMCSYR    491 - 560
EKKAEPQELLQLDGYTVDYTDPQPGLEGGRAFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSHKPV    561 - 630
PPTQVQKLNAKGGNVPQLDAPISQFYADRAQKHGMDEFISSNPCNFDHASLFEMVQRLTLDHRLNDSYSC    631 - 700
LGWFSPGQVFVLDEYCARNGVRGCHRHLCYLRDLLERAENGAMIDPTLLHYSFAFCASHVHGNRPDGIGT    701 - 770
VTVEEKERFEEIKERLRVLLENQITHFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPQEEVKTVIRK    771 - 840
CLEQAALVNYSRLSEYAKIEENQKDAENVGRLITPAKKLEDTIRLAELVIEVLQQNEEHHAEPHVDKGEA    841 - 910
FAWWSDLMVEHAETFLSLFAVDMDAALEVQPPDTWDSFPLFQLLNDFLRTDYNLCNGKFHKHLQDLFAPL    911 - 980
VVRYVDLMESSIAQSIHRGFERESWEPVKSLTSNLPNVNLPNVNLPKVPNLPVNIPLGIPQMPTFSAPSW    981 - 1050
MAAIYDADNGSGTSEDLFWKLDALQTFIRDLHWPEEEFGKHLEQRLKLMASDMIESCVKRTRIAFEVKLQ   1051 - 1120
KTSRSTDFRVPQSICTMFNVMVDAKAQSTKLCSMEMGQEHQYHSKIDELIEETVKEMITLLVAKFVTILE   1121 - 1190
GVLAKLSRYDEGTLFSSFLSFTVKAASKYVDVPKPGMDVADAYVTFVRHSQDVLRDKVNEEMYIERLFDQ   1191 - 1260
WYNSSMNVICTWLTDRMDLQLHIYQLKTLIRMVKKTYRDFRLQGVLDSTLNSKTYETIRNRLTVEEATAS   1261 - 1330
VSEGGGLQGISMKDSDEEDEEDD                                                  1331 - 1353
//

Text Mined References (29)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23801330 2013 Calcium-dependent activator protein for secretion 1 (CAPS1) binds to syntaxin-1 in a distinct mode from Munc13-1.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22566634 2012 The genetic architecture of economic and political preferences.
21798848 2011 Genome-wide molecular characterization of central nervous system primitive neuroectodermal tumor and pineoblastoma.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21601610 2011 Expression of Ca²?-dependent activator protein for secretion 2 is increased in the brains of schizophrenic patients.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...