Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.35
PubTator Score 0.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 2.5e-11
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Bipolar Disorder 666 0.0 1.4

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -3.349 2.5e-11

AA Sequence

MRRNSSLSFQMERPLEEQVQSKWSSSQGRTGTGGSDVLQMQNSEHHGQSIKTQTDSISLEDVAVNFTLEE      1 - 70
WALLDPGQRNIYRDVMRATFKNLACIGEKWKDQDIEDEHKNQGRNLRSPMVEALCENKEDCPCGKSTSQI     71 - 140
PDLNTNLETPTGLKPCDCSVCGEVFMHQVSLNRHMRSHTEQKPNECHEYGEKPHKCKECGKTFTRSSSIR    141 - 210
THERIHTGEKPYECKECGKAFAFLFSFRNHIRIHTGETPYECKECGKAFRYLTALRRHEKNHTGEKPYKC    211 - 280
KQCGKAFIYYQPFLTHERTHTGEKPYECKQCGKAFSCPTYLRSHEKTHTGEKPFVCRECGRAFFSHSSLR    281 - 350
KHVKTHTGVQPYTCKKCGEAFKSSSSCEVHERTHFGEKPYECKQCGKAFNSSSYLQLHERVHTGEKTYEC    351 - 420
KECGKAFLYSTHFRIHERTHTREKPYECKQCGRVFIYFSHLRRHERSHTGVKPCECKQCGKAFTCLNSLK    421 - 490
VHKRIHTGERPFQCRQCGKAFSYSKSLHVHERTHSRQKP                                   491 - 529
//

Text Mined References (6)

PMID Year Title