Property Summary

NCBI Gene PubMed Count 25
PubMed Score 199.60
PubTator Score 47.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.100 2.0e-02
astrocytic glioma 1.800 1.9e-02
Astrocytoma, Pilocytic 1.800 7.7e-06
atypical teratoid / rhabdoid tumor 1.600 8.5e-03
cystic fibrosis 1.455 2.1e-04
ependymoma 2.100 2.3e-02
glioblastoma 1.800 6.4e-06
group 3 medulloblastoma 3.100 1.3e-04
interstitial cystitis -1.300 3.3e-04
intraductal papillary-mucinous adenoma (... 2.400 1.4e-03
medulloblastoma, large-cell 1.800 3.3e-03
non-small cell lung cancer 1.430 2.5e-08
oligodendroglioma 1.900 4.8e-03
pituitary cancer 1.700 1.7e-05
primitive neuroectodermal tumor 2.900 3.5e-05
subependymal giant cell astrocytoma -1.367 3.8e-02

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (15)

AA Sequence

MDTESQYSGYSYKSGHSRSSRKHRDRRDRHRSKSRDGGRGDKSVTIQAPGEPLLDNESTRGDERDDNWGE      1 - 70
TTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDCSRHLGVAAGATLALLSFLTPLAFLLLPPLLWREELEP     71 - 140
CGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFVLRALLMVLVFLLVVSYWLFYGVRILDARER    141 - 210
SYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYY    211 - 280
HDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHER    281 - 350
RVRKRRARLVVAVEEAFTHIKRLQEEEQKNPREVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESI    351 - 420
LQHLEFCITHDMTPKAFLERYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLLKRQDFSLVVS    421 - 490
TKKVPFFKLSEEFVDPKSHKFVMRLQSETSV                                           491 - 521
//

Text Mined References (25)

PMID Year Title