Property Summary

NCBI Gene PubMed Count 22
Grant Count 2
Funding $133,375
PubMed Score 9.38
PubTator Score 10.23

Knowledge Summary

Patent (2,951)

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma -1.300 0.009
group 3 medulloblastoma -2.000 0.000
atypical teratoid/rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -1.400 0.000
lung carcinoma 1.500 0.000
facioscapulohumeral dystrophy 2.600 0.000

Gene RIF (9)

PMID Text
24916645 GRID1 expression is downregulated in both MECP2- and CDKL5-mutated iPS cells and upregulated in neuronal precursors and mature neurons.
23017809 GRID1 genotype is related to gray matter variation in prefrontal and anterior thalamic brain areas in healthy subjects, but not in schizophrenia patients, indicating a potential role in thalamo-cortical functioning.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19584346 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19346103 The results of this study suggested that genetic variants in the GRID1 transcriptional regulatory region may play a role in the etiology of schizophrenia.
19346103 Observational study of gene-disease association. (HuGE Navigator)
17490860 Observational study of gene-disease association. (HuGE Navigator)
17490860 results strongly support previously reported association studies, implicating GRID1 in the etiology of schizophrenia
16380905 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEALTLWLLPWICQCVSVRADSIIHIGAIFEENAAKDDRVFQLAVSDLSLNDDILQSEKITYSIKVIEAN      1 - 70
NPFQAVQEACDLMTQGILALVTSTGCASANALQSLTDAMHIPHLFVQRNPGGSPRTACHLNPSPDGEAYT     71 - 140
LASRPPVRLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQSFLDQASRLGLDVSLQKVDKNISHVFTSLFT    141 - 210
TMKTEELNRYRDTLRRAILLLSPQGAHSFINEAVETNLASKDSHWVFVNEEISDPEILDLVHSALGRMTV    211 - 280
VRQIFPSAKDNQKCTRNNHRISSLLCDPQEGYLQMLQISNLYLYDSVLMLANAFHRKLEDRKWHSMASLN    281 - 350
CIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKG    351 - 420
LNGSLQERPMGSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGFKYEIYQAPDG    421 - 490
RYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSVGILIKKPEEKISIFSLFAP    491 - 560
FDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPSASATLHSAIWIVYGAFVQQGGESSVNSMAM    561 - 630
RIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSKQVEMSYGTVRDSAVYEYFRAKGTNPLE    631 - 700
QDSTFAELWRTISKNGGADNCVSSPSEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVTVIGNSISSKGY    701 - 770
GIALQHGSPYRDLFSQRILELQDTGDLDVLKQKWWPHMGRCDLTSHASAQADGKSLKLHSFAGVFCILAI    771 - 840
GLLLACLVAALELWWNSNRCHQETPKEDKEVNLEQVHRRMNSLMDEDIAHKQISPASIELSALEMGGLAP    841 - 910
TQTLEPTREYQNTQLSVSTFLPEQSSHGTSRTLSSGPSSNLPLPLSSSATMPSMQCKHRSPNGGLFRQSP    911 - 980
VKTPIPMSFQPVPGGVLPEALDTSHGTSI                                             981 - 1009
//

Text Mined References (24)

PMID Year Title
24916645 2015 GluD1 is a common altered player in neuronal differentiation from both MECP2-mutated and CDKL5-mutated iPS cells.
24121790 2013 A genome-wide association study identifies new susceptibility loci for esophageal adenocarcinoma and Barrett's esophagus.
23726511 2013 Genome-wide association study identifies new susceptibility loci for posttraumatic stress disorder.
23568457 2013 Genetic variants associated with disordered eating.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
23180869 2014 Genome-wide association study of survival in patients with pancreatic adenocarcinoma.
23017809 2012 Glutamate receptor ? 1 (GRID1) genetic variation and brain structure in schizophrenia.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19584346 2009 Genetic variants associated with cardiac structure and function: a meta-analysis and replication of genome-wide association data.
More...