Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.68
PubTator Score 2.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
Breast cancer 3099 1.23225533184472E-15
psoriasis 6685 2.43766459474939E-14
non-small cell lung cancer 2798 5.15518813071425E-14
juvenile dermatomyositis 1189 7.52792594062723E-12
Pick disease 1893 4.57727786530314E-7
adrenocortical carcinoma 1427 7.46472647462675E-7
pituitary cancer 1972 3.86141153437183E-6
atypical teratoid/rhabdoid tumor 1095 4.19653279271761E-5
osteosarcoma 7933 4.27100314260255E-4
tuberculosis 1563 6.97993033340627E-4
medulloblastoma, large-cell 6234 9.3731788805722E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00108750061011748
ovarian cancer 8492 0.0115729872307572
Alzheimer's disease 644 0.029102828885383
invasive ductal carcinoma 2950 0.0490148648331276
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Down syndrome 548 4.312 2.2
Atrioventricular septal defect 14 3.81 1.9

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma 1.539 0.000
atypical teratoid/rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.300 0.001
juvenile dermatomyositis 1.146 0.000
adrenocortical carcinoma -1.759 0.000
pancreatic ductal adenocarcinoma liver m... -1.865 0.001
tuberculosis -1.400 0.001
non-small cell lung cancer -1.064 0.000
invasive ductal carcinoma -1.360 0.049
psoriasis -1.400 0.000
Alzheimer's disease 1.100 0.029
Pick disease 2.000 0.000
Breast cancer -1.200 0.000
ovarian cancer 1.300 0.012
pituitary cancer -1.500 0.000

Synonym

Accession Q9ULJ3 Q5R2W1 Q5R2W2 Q6P4R0
Symbols ZNF295

Gene

PDB

1WJP  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG

 GWAS Trait (1)

Pathway (1)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15629158 ZNF295 may be involved in the bi-directional control of gene expression in concert with ZFP161

AA Sequence

MEGLLHYINPAHAISLLSALNEERLKGQLCDVLLIVGDQKFRAHKNVLAASSEYFQSLFTNKENESQTVF      1 - 70
QLDFCEPDAFDNVLNYIYSSSLFVEKSSLAAVQELGYSLGISFLTNIVSKTPQAPFPTCPNRKKVFVEDD     71 - 140
ENSSQKRSVIVCQSRNEAQGKTVSQNQPDVSHTSRPSPSIAVKANTNKPHVPKPIEPLHNLSLTEKSWPK    141 - 210
DSSVVYAKSLEHSGSLDDPNRISLVKRNAVLPSKPLQDREAMDDKPGVSGQLPKGKALELALKRPRPPVL    211 - 280
SVCSSSETPYLLKETNKGNGQGEDRNLLYYSKLGLVIPSSGSGSGNQSIDRSGPLVKSLLRRSLSMDSQV    281 - 350
PVYSPSIDLKSSQGSSSVSSDAPGNVLCALSQKSSLKDCSEKTALDDRPQVLQPHRLRSFSASQSTDREG    351 - 420
ASPVTEVRIKTEPSSPLSDPSDIIRVTVGDAATTAAASSSSVTRDLSLKTEDDQKDMSRLPAKRRFQADR    421 - 490
RLPFKKLKVNEHGSPVSEDNFEEGSSPTLLDADFPDSDLNKDEFGELEGTRPNKKFKCKHCLKIFRSTAG    491 - 560
LHRHVNMYHNPEKPYACDICHKRFHTNFKVWTHCQTQHGIVKNPSPASSSHAVLDEKFQRKLIDIVRERE    561 - 630
IKKALIIKLRRGKPGFQGQSSSQAQQVIKRNLRSRAKGAYICTYCGKAYRFLSQFKQHIKMHPGEKPLGV    631 - 700
NKVAKPKEHAPLASPVENKEVYQCRLCNAKLSSLLEQGSHERLCRNAAVCPYCSLRFFSPELKQEHESKC    701 - 770
EYKKLTCLECMRTFKSSFSIWRHQVEVHNQNNMAPTENFSLPVLDHNGDVTGSSRPQSQPEPNKVNHIVT    771 - 840
TKDDNVFSDSSEQVNFDSEDSSCLPEDLSLSKQLKIQVKEEPVEEAEEEAPEASTAPKEAGPSKEASLWP    841 - 910
CEKCGKMFTVHKQLERHQELLCSVKPFICHVCNKAFRTNFRLWSHFQSHMSQASEESAHKESEVCPVPTN    911 - 980
SPSPPPLPPPPPLPKIQPLEPDSPTGLSENPTPATEKLFVPQESDTLFYHAPPLSAITFKRQFMCKLCHR    981 - 1050
TFKTAFSLWSHEQTHN                                                         1051 - 1066
//

Text Mined References (25)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21029866 2010 Nucleosome-interacting proteins regulated by DNA and histone methylation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...