Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.18
PubTator Score 2.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma -1.759 7.5e-07
Alzheimer's disease 1.100 2.9e-02
atypical teratoid / rhabdoid tumor -1.400 7.9e-04
Breast cancer -1.200 1.2e-15
invasive ductal carcinoma -1.360 4.9e-02
juvenile dermatomyositis 1.146 7.5e-12
medulloblastoma, large-cell -1.300 9.4e-04
non-small cell lung cancer -1.064 5.2e-14
osteosarcoma 1.539 4.3e-04
ovarian cancer -1.100 1.3e-02
pancreatic ductal adenocarcinoma liver m... -1.865 1.1e-03
Pick disease 2.000 4.6e-07
pituitary cancer -1.500 3.9e-06
psoriasis -1.400 2.4e-14
tuberculosis -1.400 7.0e-04

Gene RIF (2)

AA Sequence

MEGLLHYINPAHAISLLSALNEERLKGQLCDVLLIVGDQKFRAHKNVLAASSEYFQSLFTNKENESQTVF      1 - 70
QLDFCEPDAFDNVLNYIYSSSLFVEKSSLAAVQELGYSLGISFLTNIVSKTPQAPFPTCPNRKKVFVEDD     71 - 140
ENSSQKRSVIVCQSRNEAQGKTVSQNQPDVSHTSRPSPSIAVKANTNKPHVPKPIEPLHNLSLTEKSWPK    141 - 210
DSSVVYAKSLEHSGSLDDPNRISLVKRNAVLPSKPLQDREAMDDKPGVSGQLPKGKALELALKRPRPPVL    211 - 280
SVCSSSETPYLLKETNKGNGQGEDRNLLYYSKLGLVIPSSGSGSGNQSIDRSGPLVKSLLRRSLSMDSQV    281 - 350
PVYSPSIDLKSSQGSSSVSSDAPGNVLCALSQKSSLKDCSEKTALDDRPQVLQPHRLRSFSASQSTDREG    351 - 420
ASPVTEVRIKTEPSSPLSDPSDIIRVTVGDAATTAAASSSSVTRDLSLKTEDDQKDMSRLPAKRRFQADR    421 - 490
RLPFKKLKVNEHGSPVSEDNFEEGSSPTLLDADFPDSDLNKDEFGELEGTRPNKKFKCKHCLKIFRSTAG    491 - 560
LHRHVNMYHNPEKPYACDICHKRFHTNFKVWTHCQTQHGIVKNPSPASSSHAVLDEKFQRKLIDIVRERE    561 - 630
IKKALIIKLRRGKPGFQGQSSSQAQQVIKRNLRSRAKGAYICTYCGKAYRFLSQFKQHIKMHPGEKPLGV    631 - 700
NKVAKPKEHAPLASPVENKEVYQCRLCNAKLSSLLEQGSHERLCRNAAVCPYCSLRFFSPELKQEHESKC    701 - 770
EYKKLTCLECMRTFKSSFSIWRHQVEVHNQNNMAPTENFSLPVLDHNGDVTGSSRPQSQPEPNKVNHIVT    771 - 840
TKDDNVFSDSSEQVNFDSEDSSCLPEDLSLSKQLKIQVKEEPVEEAEEEAPEASTAPKEAGPSKEASLWP    841 - 910
CEKCGKMFTVHKQLERHQELLCSVKPFICHVCNKAFRTNFRLWSHFQSHMSQASEESAHKESEVCPVPTN    911 - 980
SPSPPPLPPPPPLPKIQPLEPDSPTGLSENPTPATEKLFVPQESDTLFYHAPPLSAITFKRQFMCKLCHR    981 - 1050
TFKTAFSLWSHEQTHN                                                         1051 - 1066
//

Text Mined References (26)

PMID Year Title