Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.12
PubTator Score 4.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
adult high grade glioma 3801 1.9e-04
diabetes mellitus 1728 1.4e-03
astrocytic glioma 2597 3.1e-03
ependymoma 4679 5.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Liver cancer 604 0.0 0.5
Disease Target Count Z-score Confidence
Antisocial personality disorder 9 3.625 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.100 1.9e-04
astrocytic glioma -1.100 3.1e-03
diabetes mellitus 1.100 1.4e-03
ependymoma -1.200 5.3e-03

Gene RIF (3)

AA Sequence

METLLGGLLAFGMAFAVVDACPKYCVCQNLSESLGTLCPSKGLLFVPPDIDRRTVELRLGGNFIIHISRQ      1 - 70
DFANMTGLVDLTLSRNTISHIQPFSFLDLESLRSLHLDSNRLPSLGEDTLRGLVNLQHLIVNNNQLGGIA     71 - 140
DEAFEDFLLTLEDLDLSYNNLHGLPWDSVRRMVNLHQLSLDHNLLDHIAEGTFADLQKLARLDLTSNRLQ    141 - 210
KLPPDPIFARSQASALTATPFAPPLSFSFGGNPLHCNCELLWLRRLERDDDLETCGSPGGLKGRYFWHVR    211 - 280
EEEFVCEPPLITQHTHKLLVLEGQAATLKCKAIGDPSPLIHWVAPDDRLVGNSSRTAVYDNGTLDIFITT    281 - 350
SQDSGAFTCIAANAAGEATAMVEVSIVQLPHLSNSTSRTAPPKSRLSDITGSSKTSRGGGGSGGGEPPKS    351 - 420
PPERAVLVSEVTTTSALVKWSVSKSAPRVKMYQLQYNCSDDEVLIYRMIPASNKAFVVNNLVSGTGYDLC    421 - 490
VLAMWDDTATTLTATNIVGCAQFFTKADYPQCQSMHSQILGGTMILVIGGIIVATLLVFIVILMVRYKVC    491 - 560
NHEAPSKMAAAVSNVYSQTNGAQPPPPSSAPAGAPPQGPPKVVVRNELLDFTASLARASDSSSSSSLGSG    561 - 630
EAAGLGRAPWRIPPSAPRPKPSLDRLMGAFASLDLKSQRKEELLDSRTPAGRGAGTSARGHHSDREPLLG    631 - 700
PPAARARSLLPLPLEGKAKRSHSFDMGDFAAAAAGGVVPGGYSPPRKVSNIWTKRSLSVNGMLLPFEESD    701 - 770
LVGARGTFGSSEWVMESTV                                                       771 - 789
//

Text Mined References (14)

PMID Year Title