Property Summary

NCBI Gene PubMed Count 32
Grant Count 8
R01 Count 6
Funding $468,973.25
PubMed Score 264.25
PubTator Score 42.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 1.200 0.042

Gene RIF (20)

PMID Text
26340092 INO80 complex negatively regulates p21 expression in a p53-mediated mechanism and is implicated in cell cycle phase G2/M arrest and abnormal chromosome stability.
25283999 INO80 is stabilized and targeted to replication forks by BAP1 during normal DNA synthesis but downregulated in BAP1 defective cancer cells
25016522 The data indicate that under conditions of replication stress INO80 protects stalled forks from collapsing and allows their subsequent restart.
24899691 Mutations in INO80D is associated with translocation renal cell carcinoma.
24297934 human Inositol auxotrophy 80 (Ino80) SNF2 ATPase is subject to regulation at multiple levels in the INO80 chromatin-remodeling complex.
22166198 These results suggest that the human INO80 complex, like the yeast complex, was involved in the DNA damage tolerance pathway and that phosphorylation of human INO80 was involved in the DNA damage tolerance pathway.
22133677 These results suggest that hIno80 can play a direct role in the spindle assembly independent of its chromatin remodeling activity.
21947284 Ino80 mediates double-strand break repair through its role in DNA end strand resection
21303910 Subunit organization of the human INO80 chromatin remodeling complex: an evolutionarily conserved core complex catalyzes ATP-dependent nucleosome remodeling.
20687897 These results suggest that hINO80 assists double-strand break repair by positively regulating the expression of the Rad54B and XRCC3 genes.
More...

AA Sequence

MASELGARDDGGCTELAKPLYLQYLERALRLDHFLRQTSAIFNRNISSDDSEDGLDDSNPLLPQSGDPLI      1 - 70
QVKEEPPNSLLGETSGAGSSGMLNTYSLNGVLQSESKCDKGNLYNFSKLKKSRKWLKSILLSDESSEADS     71 - 140
QSEDDDEEELNLSREELHNMLRLHKYKKLHQNKYSKDKELQQYQYYSAGLLSTYDPFYEQQRHLLGPKKK    141 - 210
KFKEEKKLKAKLKKVKKKRRRDEELSSEESPRRHHHQTKVFAKFSHDAPPPGTKKKHLSIEQLNARRRKV    211 - 280
WLSIVKKELPKANKQKASARNLFLTNSRKLAHQCMKEVRRAALQAQKNCKETLPRARRLTKEMLLYWKKY    281 - 350
EKVEKEHRKRAEKEALEQRKLDEEMREAKRQQRKLNFLITQTELYAHFMSRKRDMGHDGIQEEILRKLED    351 - 420
SSTQRQIDIGGGVVVNITQEDYDSNHFKAQALKNAENAYHIHQARTRSFDEDAKESRAAALRAANKSGTG    421 - 490
FGESYSLANPSIRAGEDIPQPTIFNGKLKGYQLKGMNWLANLYEQGINGILADEMGLGKTVQSIALLAHL    491 - 560
AERENIWGPFLIISPASTLNNWHQEFTRFVPKFKVLPYWGNPHDRKVIRRFWSQKTLYTQDAPFHVVITS    561 - 630
YQLVVQDVKYFQRVKWQYMVLDEAQALKSSSSVRWKILLQFQCRNRLLLTGTPIQNTMAELWALLHFIMP    631 - 700
TLFDSHEEFNEWFSKDIESHAENKSAIDENQLSRLHMILKPFMLRRIKKDVENELSDKIEILMYCQLTSR    701 - 770
QKLLYQALKNKISIEDLLQSSMGSTQQAQNTTSSLMNLVMQFRKVCNHPELFERQETWSPFHISLKPYHI    771 - 840
SKFIYRHGQIRVFNHSRDRWLRVLSPFAPDYIQRSLFHRKGINEESCFSFLRFIDISPAEMANLMLQGLL    841 - 910
ARWLALFLSLKASYRLHQLRSWGAPEGESHQRYLRNKDFLLGVNFPLSFPNLCSCPLLKSLVFSSHCKAV    911 - 980
SGYSDQVVHQRRSATSSLRRCLLTELPSFLCVASPRVTAVPLDSYCNDRSAEYERRVLKEGGSLAAKQCL    981 - 1050
LNGAPELAADWLNRRSQFFPEPAGGLWSIRPQNGWSFIRIPGKESLITDSGKLYALDVLLTRLKSQGHRV   1051 - 1120
LIYSQMTRMIDLLEEYMVYRKHTYMRLDGSSKISERRDMVADFQNRNDIFVFLLSTRAGGLGINLTAADT   1121 - 1190
VIFYDSDWNPTVDQQAMDRAHRLGQTKQVTVYRLICKGTIEERILQRAKEKSEIQRMVISGGNFKPDTLK   1191 - 1260
PKEVVSLLLDDEELEKKLRLRQEEKRQQEETNRVKERKRKREKYAEKKKKEDELDGKRRKEGVNLVIPFV   1261 - 1330
PSADNSNLSADGDDSFISVDSAMPSPFSEISISSELHTGSIPLDESSSDMLVIVDDPASSAPQSRATNSP   1331 - 1400
ASITGSVSDTVNGISIQEMPAAGRGHSARSRGRPKGSGSTAKGAGKGRSRKSTAGSAAAMAGAKAGAAAA   1401 - 1470
SAAAYAAYGYNVSKGISASSPLQTSLVRPAGLADFGPSSASSPLSSPLSKGNNVPGNPKNLHMTSSLAPD   1471 - 1540
SLVRKQGKGTNPSGGR                                                         1541 - 1556
//

Text Mined References (38)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26340092 2015 Negative Regulation of p21Waf1/Cip1 by Human INO80 Chromatin Remodeling Complex Is Implicated in Cell Cycle Phase G2/M Arrest and Abnormal Chromosome Stability.
25283999 2014 Stabilization and targeting of INO80 to replication forks by BAP1 during normal DNA synthesis.
25016522 2014 The mammalian INO80 chromatin remodeling complex is required for replication stress recovery.
24899691 2014 Next-generation sequencing of translocation renal cell carcinoma reveals novel RNA splicing partners and frequent mutations of chromatin-remodeling genes.
24297934 2013 Multiple modes of regulation of the human Ino80 SNF2 ATPase by subunits of the INO80 chromatin-remodeling complex.
22749148 2012 The RSC and INO80 chromatin-remodeling complexes in DNA double-strand break repair.
22166198 2012 Phosphorylation of human INO80 is involved in DNA damage tolerance.
22133677 2011 The human Ino80 binds to microtubule via the E-hook of tubulin: implications for the role in spindle assembly.
21947284 2011 Mammalian Ino80 mediates double-strand break repair through its role in DNA end strand resection.
More...