Property Summary

Ligand Count 5
NCBI Gene PubMed Count 18
PubMed Score 51.69
PubTator Score 561.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 4.4e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
lung cancer 4740 0.0 0.5
Disease Target Count Z-score Confidence
Epidermolytic hyperkeratosis 14 3.142 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.627 4.4e-07

Synonym

Accession Q9ULC6 A1L4K6 Q70SX6
Symbols PDI
PAD1
PDI1
HPAD10

Gene

PDB

5HP5  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (10)

AA Sequence

MAPKRVVQLSLKMPTHAVCVVGVEAHVDIHSDVPKGANSFRVSGSSGVEVFMVYNRTRVKEPIGKARWPL      1 - 70
DTDADMVVSVGTASKELKDFKVRVSYFGEQEDQALGRSVLYLTGVDISLEVDTGRTGKVKRSQGDKKTWR     71 - 140
WGPEGYGAILLVNCDRDNHRSAEPDLTHSWLMSLADLQDMSPMLLSCNGPDKLFDSHKLVLNVPFSDSKR    141 - 210
VRVFCARGGNSLSDYKQVLGPQCLSYEVERQPGEQEIKFYVEGLTFPDADFLGLVSLSVSLVDPGTLPEV    211 - 280
TLFTDTVGFRMAPWIMTPNTQPPEELYVCRVMDTHGSNEKFLEDMSYLTLKANCKLTICPQVENRNDRWI    281 - 350
QDEMEFGYIEAPHKSFPVVFDSPRNRGLKDFPYKRILGPDFGYVTREIPLPGPSSLDSFGNLDVSPPVTV    351 - 420
GGTEYPLGRILIGSSFPKSGGRQMARAVRNFLKAQQVQAPVELYSDWLSVGHVDEFLTFVPTSDQKGFRL    421 - 490
LLASPSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDNLHAQKCIDWNRNVLKRELGL    491 - 560
AESDIVDIPQLFFLKNFYAEAFFPDMVNMVVLGKYLGIPKPYGPIINGRCCLEEKVQSLLEPLGLHCIFI    561 - 630
DDYLSYHELQGEIHCGTNVRRKPFPFKWWNMVP                                         631 - 663
//

Text Mined References (19)

PMID Year Title