Property Summary

NCBI Gene PubMed Count 16
Grant Count 15
R01 Count 15
Funding $2,589,311.83
PubMed Score 48.77
PubTator Score 561.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.627 0.000

MLP Assay (12)

AID Type Active / Inconclusive / Inactive Description
588438 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 1 against PAD1-4
588462 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of streptonigrin against PAD1-3
588471 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 3 against PAD1-4
588472 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 14 against PAD1-4
588484 confirmatory 0 / 0 / 1 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 10 against PAD1-4
588486 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 21 against PAD1-4
588487 other 35 / 0 / 44 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): fluorescence-based biochemical gel-based competitive Activity-Based Protein Profiling (ABPP) inhibition by HTS hits of PADs 1-4
588488 other 0 / 0 / 34 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of HTS hits against PAD1-4
588490 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 17 against PAD1-4
588560 other 12 / 0 / 18 Late stage assay provider results from the probe development effort to identify inhibitors of PAD4: colorimetric biochemical substrate assay to identify inhibitors of PADs 1-4
More...

Gene RIF (8)

PMID Text
20596086 NF-kappaB-mediated signaling pathway is involved in PADI1 regulation in human epidermal keratinocytes
18710930 peptidylarginine deiminase citrullinates the chemokine CXCL8, and thus may dampen neutrophil extravasation during acute or chronic inflammation
18669583 The expressoin of COL1A1-PADI1 genes were particularly effective in distinguishing OCSS from normal tissue.
17851584 MZF1 and Sp1/Sp3 binding to the promoter region drive the PADI1 expression in keratinocytes
16091842 PAD1 is co-located with filaggrin within the filamentous matrix of the deeper corneocytes where the protein is deiminated.
15675958 PAD1 and 3 are able to modify filaggrin
15150696 peptidylarginine deiminase types 1 and 3 loci map to chromosomal band 1p36.13
12416996 cloning, gene organization, and expression analysis

AA Sequence

MAPKRVVQLSLKMPTHAVCVVGVEAHVDIHSDVPKGANSFRVSGSSGVEVFMVYNRTRVKEPIGKARWPL      1 - 70
DTDADMVVSVGTASKELKDFKVRVSYFGEQEDQALGRSVLYLTGVDISLEVDTGRTGKVKRSQGDKKTWR     71 - 140
WGPEGYGAILLVNCDRDNHRSAEPDLTHSWLMSLADLQDMSPMLLSCNGPDKLFDSHKLVLNVPFSDSKR    141 - 210
VRVFCARGGNSLSDYKQVLGPQCLSYEVERQPGEQEIKFYVEGLTFPDADFLGLVSLSVSLVDPGTLPEV    211 - 280
TLFTDTVGFRMAPWIMTPNTQPPEELYVCRVMDTHGSNEKFLEDMSYLTLKANCKLTICPQVENRNDRWI    281 - 350
QDEMEFGYIEAPHKSFPVVFDSPRNRGLKDFPYKRILGPDFGYVTREIPLPGPSSLDSFGNLDVSPPVTV    351 - 420
GGTEYPLGRILIGSSFPKSGGRQMARAVRNFLKAQQVQAPVELYSDWLSVGHVDEFLTFVPTSDQKGFRL    421 - 490
LLASPSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDNLHAQKCIDWNRNVLKRELGL    491 - 560
AESDIVDIPQLFFLKNFYAEAFFPDMVNMVVLGKYLGIPKPYGPIINGRCCLEEKVQSLLEPLGLHCIFI    561 - 630
DDYLSYHELQGEIHCGTNVRRKPFPFKWWNMVP                                         631 - 663
//

Publication (17)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20596086 2010 An intronic enhancer driven by NF-?B contributes to transcriptional regulation of peptidylarginine deiminase type I gene in human keratinocytes.
18710930 2008 Citrullination of CXCL8 by peptidylarginine deiminase alters receptor usage, prevents proteolysis, and dampens tissue inflammation.
18669583 2008 Gene expression profiling identifies genes predictive of oral squamous cell carcinoma.
17851584 2008 Crucial roles of MZF1 and Sp1 in the transcriptional regulation of the peptidylarginine deiminase type I gene (PADI1) in human keratinocytes.
16973334 2006 Peptidylarginine deiminases and deimination in biology and pathology: relevance to skin homeostasis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16091842 2005 The peptidylarginine deiminases expressed in human epidermis differ in their substrate specificities and subcellular locations.
15675958 2005 Peptidylarginine deiminase isoforms 1-3 are expressed in the epidermis and involved in the deimination of K1 and filaggrin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...