Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
Funding $1,164,807.72
PubMed Score 17.78
PubTator Score 13.06

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
26831939 These results indicate that endomucin prevents leukocyte contact with adhesion molecules in non-inflamed tissues and that downregulation of endomucin is critical to facilitate adhesion of leukocytes into inflamed tissues.
21666600 Knockdown of endomucin markedly attenuated endothelial cell growth, migration and tube formation.
21159824 A significant association between EMCN and rheumatoid arthritis susceptibility was detected in our Japanese study population. The EMCN allele conferring rheumatoid arthritis susceptibility may also contribute to the pathogenesis of rheumatoid arthritis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MELLQVTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELL      1 - 70
KMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGS     71 - 140
VLQPDASPSKTGTLTSIPVTIPENTSQSQVIGTEGGKNASTSATSRSYSSIILPVVIALIVITLSVFVLV    141 - 210
GLYRMCWKADPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN                       211 - 261
//

Text Mined References (18)

PMID Year Title
26831939 2016 Endomucin prevents leukocyte-endothelial cell adhesion and has a critical role under resting and inflammatory conditions.
22566498 2012 Genomic association analysis identifies multiple loci influencing antihypertensive response to an angiotensin II receptor blocker.
21666600 2011 Epigenetically coordinated GATA2 binding is necessary for endothelium-specific endomucin expression.
21159824 2011 Association of EMCN with susceptibility to rheumatoid arthritis in a Japanese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15249540 2004 Endomucin, a sialomucin expressed in high endothelial venules, supports L-selectin-mediated rolling.
14722670 2004 Identification of tumour antigens by serological analysis of cDNA expression cloning.
More...