Property Summary

NCBI Gene PubMed Count 17
PubMed Score 22.86
PubTator Score 13.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -1.702 1.6e-04
astrocytic glioma -1.200 4.1e-02
Astrocytoma, Pilocytic 1.100 1.5e-04
breast carcinoma -1.200 3.1e-04
diabetes mellitus -1.200 1.2e-03
ductal carcinoma in situ -1.200 2.6e-04
group 3 medulloblastoma 1.300 1.9e-03
interstitial cystitis 1.200 3.1e-04
intraductal papillary-mucinous adenoma (... -1.300 8.7e-06
intraductal papillary-mucinous carcinoma... -1.300 1.8e-05
intraductal papillary-mucinous neoplasm ... -1.500 1.9e-04
invasive ductal carcinoma -2.300 1.9e-04
juvenile dermatomyositis 1.006 9.5e-08
lung adenocarcinoma -2.100 4.7e-13
lung cancer -2.500 5.4e-05
lung carcinoma -1.800 1.1e-08
nephrosclerosis 1.208 8.4e-05
non-inflammatory breast cancer -1.300 8.1e-04
non-small cell lung cancer -3.291 1.8e-30
ovarian cancer -1.300 3.8e-03
psoriasis -2.500 7.4e-05
ulcerative colitis 1.400 2.9e-04

Gene RIF (5)

AA Sequence

MELLQVTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELL      1 - 70
KMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGS     71 - 140
VLQPDASPSKTGTLTSIPVTIPENTSQSQVIGTEGGKNASTSATSRSYSSIILPVVIALIVITLSVFVLV    141 - 210
GLYRMCWKADPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN                       211 - 261
//

Text Mined References (19)

PMID Year Title