Property Summary

NCBI Gene PubMed Count 120
PubMed Score 125.14
PubTator Score 117.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -2.400 9.3e-06
Alzheimer's disease -1.400 3.3e-02
astrocytoma -1.300 1.1e-09
Astrocytoma, Pilocytic -1.600 8.6e-05
atypical teratoid / rhabdoid tumor -4.000 6.0e-05
Breast cancer -1.100 8.9e-09
colon cancer -1.500 1.2e-02
ependymoma -3.800 1.2e-11
glioblastoma -2.300 6.3e-05
group 4 medulloblastoma -1.500 1.0e-03
intraductal papillary-mucinous carcinoma... -1.100 2.5e-02
lung carcinoma 4.000 5.1e-46
medulloblastoma, large-cell -2.400 9.2e-05
nasopharyngeal carcinoma 2.100 1.2e-02
oligodendroglioma -1.100 3.0e-06
ovarian cancer -1.800 3.4e-05
Pick disease -2.100 2.1e-03
pituitary cancer 1.200 3.0e-05
primitive neuroectodermal tumor -1.600 1.8e-02
psoriasis -1.100 1.4e-08
subependymal giant cell astrocytoma -2.669 3.0e-02

Gene RIF (85)

AA Sequence

MGTALLQRGGCFLLCLSLLLLGCWAELGSGLEFPGAEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYF      1 - 70
DDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFIDQVEAKWVEV     71 - 140
KSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPPN    141 - 210
SGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKE    211 - 280
EYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGA    281 - 350
FEALVEPVNGKFNDNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSP    351 - 420
STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESF    421 - 490
ISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGT    491 - 560
IKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTE    561 - 630
VWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQSTAGVKPSCSKETAKPCLSNPCKNNGMCRDGWNRYVC    631 - 700
DCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLE    701 - 770
LDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHT    771 - 840
RLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIADPVTFK    841 - 910
TKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSN    911 - 980
KPLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQ    981 - 1050
GCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCN   1051 - 1120
DPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVK   1121 - 1190
FNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQG   1191 - 1260
QPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSEMSTSIMETTTTLAT   1261 - 1330
STARRGKPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRAGGREPYPGSAEVIRESSST   1331 - 1400
TGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSSNKNKKN   1401 - 1470
KDKEYYV                                                                  1471 - 1477
//

Text Mined References (122)

PMID Year Title