Property Summary

NCBI Gene PubMed Count 8
PubMed Score 404.72
PubTator Score 141.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus -1.500 2.5e-03
glioblastoma -2.000 3.6e-02
group 4 medulloblastoma -1.400 3.1e-05
malignant mesothelioma 1.300 1.0e-06
medulloblastoma, large-cell -1.400 6.3e-04
ovarian cancer 1.300 1.7e-02
pituitary cancer -1.500 9.7e-04

Gene RIF (4)

AA Sequence

MSGPGPREPPPEAGAAGGEAAVEGAGGGDAALGEPGLSFTTTDLSLVEMTEVEYTQLQHILCSHMEAAAD      1 - 70
GELETRLNSALLAAAGPGAGAGGFAAGGQGGAAPVYPVLCPSALAADAPCLGHIDFQELRMMLLSEAGAA     71 - 140
EKTSGGGDGARARADGAAKEGAGAAAAAAGPDGAPEARAKPAVRVRLEDRFNSIPAEPPPAPRGPEPPEP    141 - 210
GGALNNLVTLIRHPSELMNVPLQQQNKCTALVKNKTAATTTALQFTYPLFTTNACSTSGNSNLSQTQSSS    211 - 280
NSCSVLEAAKHQDIGLPRAFSFCYQQEIESTKQTLGSRNKVLPEQVWIKVGEAALCKQALKRNRSRMRQL    281 - 350
DTNVERRALGEIQNVGEGATATQGAWQSSESSQANLGEQAQSGPQGGRSQRRERHNRMERDRRRRIRICC    351 - 420
DELNLLVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFCGKTGRRLKLTRPDSLVTCPAQGS    421 - 490
LQSSPSMEIK                                                                491 - 500
//

Text Mined References (8)

PMID Year Title