Property Summary

NCBI Gene PubMed Count 8
Grant Count 21
R01 Count 15
Funding $3,328,605.72
PubMed Score 360.39
PubTator Score 141.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
cutaneous lupus erythematosus -1.500 0.003
glioblastoma -2.000 0.036
group 4 medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.400 0.001
ovarian cancer 1.300 0.017
pituitary cancer -1.500 0.001

Gene RIF (4)

PMID Text
24588599 HPVs16 and 18 commonly are present in normal oral mucosa and emphasize the importance of distinguishing clinical
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
18976975 Knockdown of transcription factor-like 5 (basic helix-loop-helix) (TCFL5) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
12923186 Cha is a new bHLH transcription factor that negatively regulates upstream transcription factor-dependent transcription

AA Sequence

MSGPGPREPPPEAGAAGGEAAVEGAGGGDAALGEPGLSFTTTDLSLVEMTEVEYTQLQHILCSHMEAAAD      1 - 70
GELETRLNSALLAAAGPGAGAGGFAAGGQGGAAPVYPVLCPSALAADAPCLGHIDFQELRMMLLSEAGAA     71 - 140
EKTSGGGDGARARADGAAKEGAGAAAAAAGPDGAPEARAKPAVRVRLEDRFNSIPAEPPPAPRGPEPPEP    141 - 210
GGALNNLVTLIRHPSELMNVPLQQQNKCTALVKNKTAATTTALQFTYPLFTTNACSTSGNSNLSQTQSSS    211 - 280
NSCSVLEAAKHQDIGLPRAFSFCYQQEIESTKQTLGSRNKVLPEQVWIKVGEAALCKQALKRNRSRMRQL    281 - 350
DTNVERRALGEIQNVGEGATATQGAWQSSESSQANLGEQAQSGPQGGRSQRRERHNRMERDRRRRIRICC    351 - 420
DELNLLVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFCGKTGRRLKLTRPDSLVTCPAQGS    421 - 490
LQSSPSMEIK                                                                491 - 500
//

Publication (8)

PMID Year Title
24588599 2014 PCR based detection of HPV 16 and 18 genotypes in normal oral mucosa of tobacco users and non-users.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
12923186 2003 Cha, a basic helix-loop-helix transcription factor involved in the regulation of upstream stimulatory factor activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11306602 2001 Dominant T- and B-cell epitopes in an autoantigen linked to Chagas' disease.
9763657 1998 Cloning of TCFL5 encoding a novel human basic helix-loop-helix motif protein that is specifically expressed in primary spermatocytes at the pachytene stage.