Property Summary

NCBI Gene PubMed Count 6
PubMed Score 71.62
PubTator Score 30.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.800 1.4e-05
astrocytoma -1.200 1.6e-19
Astrocytoma, Pilocytic -2.200 1.8e-09
atypical teratoid / rhabdoid tumor -1.600 7.6e-05
ependymoma -1.500 9.0e-08
facioscapulohumeral dystrophy 2.000 1.3e-04
fibroadenoma -1.100 3.7e-02
glioblastoma -1.800 1.2e-08
medulloblastoma -1.500 2.7e-05
medulloblastoma, large-cell -1.600 2.3e-03
oligodendroglioma -1.300 5.2e-16
osteosarcoma 1.502 2.6e-03
Pick disease -1.700 1.2e-03

Gene RIF (1)

AA Sequence

MPLTLLQDWCRGEHLNTRRCMLILGIPEDCGEDEFEETLQEACRHLGRYRVIGRMFRREENAQAILLELA      1 - 70
QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDMNRVLGSDTNCSAPRVTISPE     71 - 140
FWTWAQTLGAAVQPLLEQMLYRELRVFSGNTISIPGALAFDAWLEHTTEMLQMWQVPEGEKRRRLMECLR    141 - 210
GPALQVVSGLRASNASITVEECLAALQQVFGPVESHKIAQVKLCKAYQEAGEKVSSFVLRLEPLLQRAVE    211 - 280
NNVVSRRNVNQTRLKRVLSGATLPDKLRDKLKLMKQRRKPPGFLALVKLLREEEEWEATLGPDRESLEGL    281 - 350
EVAPRPPARITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKRKRHTFCYSCGED    351 - 420
GHIRVQCINPSNLLLVKQKKQAAVESGNGNWAWDKSHPKSKAK                               421 - 463
//

Text Mined References (9)

PMID Year Title