Property Summary

NCBI Gene PubMed Count 6
PubMed Score 63.76
PubTator Score 30.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -1.200 0.000
glioblastoma -2.000 0.000
oligodendroglioma -1.300 0.000
osteosarcoma 1.502 0.003
posterior fossa group A ependymoma -1.800 0.000
sonic hedgehog group medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -1.600 0.002
fibroadenoma -1.100 0.037
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -2.100 0.000
Pick disease -1.700 0.001
facioscapulohumeral dystrophy 2.000 0.000

Gene RIF (1)

PMID Text
16407312 analysis of a ribosomal frameshift signal in the human paraneoplastic Ma3 gene

AA Sequence

MPLTLLQDWCRGEHLNTRRCMLILGIPEDCGEDEFEETLQEACRHLGRYRVIGRMFRREENAQAILLELA      1 - 70
QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDMNRVLGSDTNCSAPRVTISPE     71 - 140
FWTWAQTLGAAVQPLLEQMLYRELRVFSGNTISIPGALAFDAWLEHTTEMLQMWQVPEGEKRRRLMECLR    141 - 210
GPALQVVSGLRASNASITVEECLAALQQVFGPVESHKIAQVKLCKAYQEAGEKVSSFVLRLEPLLQRAVE    211 - 280
NNVVSRRNVNQTRLKRVLSGATLPDKLRDKLKLMKQRRKPPGFLALVKLLREEEEWEATLGPDRESLEGL    281 - 350
EVAPRPPARITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKRKRHTFCYSCGED    351 - 420
GHIRVQCINPSNLLLVKQKKQAAVESGNGNWAWDKSHPKSKAK                               421 - 463
//

Text Mined References (9)

PMID Year Title
19366867 2009 Paraneoplastic antigen-like 5 gene (PNMA5) is preferentially expressed in the association areas in a primate specific manner.
16407312 2006 A functional -1 ribosomal frameshift signal in the human paraneoplastic Ma3 gene.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16214224 2005 The human PNMA family: novel neuronal proteins implicated in paraneoplastic neurological disease.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11558790 2001 Molecular and clinical diversity in paraneoplastic immunity to Ma proteins.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.