Property Summary

NCBI Gene PubMed Count 6
PubMed Score 63.76
PubTator Score 30.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
astrocytoma 1493 1.59974686662319E-19
oligodendroglioma 2849 5.16661394766862E-16
posterior fossa group A ependymoma 1511 5.72688006821614E-13
pilocytic astrocytoma 3086 1.40139130931827E-9
pediatric high grade glioma 2712 1.90436203711212E-8
sonic hedgehog group medulloblastoma 1482 7.0191206129683E-8
glioblastoma 5572 1.03817933361016E-5
atypical teratoid / rhabdoid tumor 4369 7.6325017666247E-5
facioscapulohumeral dystrophy 286 1.34923071101263E-4
Pick disease 1893 0.00117215882401656
medulloblastoma, large-cell 6234 0.00226752564171152
osteosarcoma 7933 0.00258980666803188
fibroadenoma 557 0.037287011897329
Disease Target Count Z-score Confidence
CD3zeta deficiency 1 4.637 2.3
Bronchitis 44 4.387 2.2

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -1.200 0.000
glioblastoma -2.000 0.000
oligodendroglioma -1.300 0.000
osteosarcoma 1.502 0.003
posterior fossa group A ependymoma -1.800 0.000
sonic hedgehog group medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -1.600 0.002
fibroadenoma -1.100 0.037
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -2.100 0.000
Pick disease -1.700 0.001
facioscapulohumeral dystrophy 2.000 0.000

Synonym

Accession Q9UL41 D3DWT7 Q9H0A4
Symbols MA3
MA5

Gene

PANTHER Protein Class (1)

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Horse OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
16407312 analysis of a ribosomal frameshift signal in the human paraneoplastic Ma3 gene

AA Sequence

MPLTLLQDWCRGEHLNTRRCMLILGIPEDCGEDEFEETLQEACRHLGRYRVIGRMFRREENAQAILLELA      1 - 70
QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDMNRVLGSDTNCSAPRVTISPE     71 - 140
FWTWAQTLGAAVQPLLEQMLYRELRVFSGNTISIPGALAFDAWLEHTTEMLQMWQVPEGEKRRRLMECLR    141 - 210
GPALQVVSGLRASNASITVEECLAALQQVFGPVESHKIAQVKLCKAYQEAGEKVSSFVLRLEPLLQRAVE    211 - 280
NNVVSRRNVNQTRLKRVLSGATLPDKLRDKLKLMKQRRKPPGFLALVKLLREEEEWEATLGPDRESLEGL    281 - 350
EVAPRPPARITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKRKRHTFCYSCGED    351 - 420
GHIRVQCINPSNLLLVKQKKQAAVESGNGNWAWDKSHPKSKAK                               421 - 463
//

Text Mined References (9)

PMID Year Title
19366867 2009 Paraneoplastic antigen-like 5 gene (PNMA5) is preferentially expressed in the association areas in a primate specific manner.
16407312 2006 A functional -1 ribosomal frameshift signal in the human paraneoplastic Ma3 gene.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16214224 2005 The human PNMA family: novel neuronal proteins implicated in paraneoplastic neurological disease.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11558790 2001 Molecular and clinical diversity in paraneoplastic immunity to Ma proteins.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.