Property Summary

NCBI Gene PubMed Count 23
PubMed Score 360.04
PubTator Score 12.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Ehlers-Danlos Syndrome, Musculocontractural Type, 2 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Ehlers-Danlos syndrome 43 3.219 1.6

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease 1.973 3.0e-02
active ulcerative colitis 2.253 7.7e-03
adrenocortical carcinoma -1.119 4.0e-04
adult high grade glioma 1.100 3.3e-02
astrocytoma 1.100 2.4e-08
Astrocytoma, Pilocytic 1.400 1.1e-05
Chronic Lymphocytic Leukemia -1.627 1.9e-04
ependymoma 1.300 2.6e-06
gastric carcinoma 1.800 3.5e-03
glioblastoma 2.900 7.4e-05
group 3 medulloblastoma 1.300 1.3e-02
intraductal papillary-mucinous adenoma (... -2.000 3.1e-02
intraductal papillary-mucinous carcinoma... -2.300 1.3e-02
lung cancer -1.500 6.7e-03
lung carcinoma -1.200 4.5e-22
malignant mesothelioma -3.000 5.8e-09
osteosarcoma 1.559 3.2e-03
ovarian cancer -5.000 1.4e-12
pancreatic cancer 1.300 1.8e-03
primary pancreatic ductal adenocarcinoma 1.271 4.6e-03
primary Sjogren syndrome 1.100 1.1e-02
psoriasis 1.400 3.5e-04
tuberculosis -2.300 4.7e-06

Gene RIF (3)

AA Sequence

MRTHTRGAPSVFFIYLLCFVSAYITDENPEVMIPFTNANYDSHPMLYFSRAEVAELQLRAASSHEHIAAR      1 - 70
LTEAVHTMLSSPLEYLPPWDPKDYSARWNEIFGNNLGALAMFCVLYPENIEARDMAKDYMERMAAQPSWL     71 - 140
VKDAPWDEVPLAHSLVGFATAYDFLYNYLSKTQQEKFLEVIANASGYMYETSYRRGWGFQYLHNHQPTNC    141 - 210
MALLTGSLVLMNQGYLQEAYLWTKQVLTIMEKSLVLLREVTDGSLYEGVAYGSYTTRSLFQYMFLVQRHF    211 - 280
NINHFGHPWLKQHFAFMYRTILPGFQRTVAIADSNYNWFYGPESQLVFLDKFVMRNGSGNWLADQIRRNR    281 - 350
VVEGPGTPSKGQRWCTLHTEFLWYDGSLKSVPPPDFGTPTLHYFEDWGVVTYGSALPAEINRSFLSFKSG    351 - 420
KLGGRAIYDIVHRNKYKDWIKGWRNFNAGHEHPDQNSFTFAPNGVPFITEALYGPKYTFFNNVLMFSPAV    421 - 490
SKSCFSPWVGQVTEDCSSKWSKYKHDLAASCQGRVVAAEEKNGVVFIRGEGVGAYNPQLNLKNVQRNLIL    491 - 560
LHPQLLLLVDQIHLGEESPLETAASFFHNVDVPFEETVVDGVHGAFIRQRDGLYKMYWMDDTGYSEKATF    561 - 630
ASVTYPRGYPYNGTNYVNVTMHLRSPITRAAYLFIGPSIDVQSFTVHGDSQQLDVFIATSKHAYATYLWT    631 - 700
GEATGQSAFAQVIADRHKILFDRNSAIKSSIVPEVKDYAAIVEQNLQHFKPVFQLLEKQILSRVRNTASF    701 - 770
RKTAERLLRFSDKRQTEEAIDRIFAISQQQQQQSKSKKNRRAGKRYKFVDAVPDIFAQIEVNEKKIRQKA    771 - 840
QILAQKELPIDEDEEMKDLLDFADVTYEKHKNGGLIKGRFGQARMVTTTHSRAPSLSASYTRLFLILNIA    841 - 910
IFFVMLAMQLTYFQRAQSLHGQRCLYAVLLIDSCILLWLYSSCSQSQC                          911 - 958
//

Text Mined References (23)

PMID Year Title