Property Summary

NCBI Gene PubMed Count 47
PubMed Score 67.92
PubTator Score 48.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 5.724139912697E-8
pilocytic astrocytoma 3086 7.27193587635267E-8
pediatric high grade glioma 2712 4.14301386720465E-6
Duchenne muscular dystrophy 602 1.08676747794791E-5
sonic hedgehog group medulloblastoma 1482 1.10123329117356E-5
glioblastoma 5572 1.47103050712637E-5
breast carcinoma 1614 5.86525153503873E-5
ulcerative colitis 2087 6.82595777371865E-5
pancreatic cancer 2300 1.1650226430702E-4
cystic fibrosis 1670 1.53071583734448E-4
limb girdle muscular dystrophy 2A 156 1.73117031173502E-4
interstitial cystitis 2299 2.1930372696904E-4
primary pancreatic ductal adenocarcinoma 1271 3.0066621020782E-4
Becker muscular dystrophy 187 3.06544340431668E-4
ovarian cancer 8492 4.8624129035843E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.30356526454458E-4
invasive ductal carcinoma 2950 7.60796832960807E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00106695858478458
diabetes mellitus 1663 0.00175053489365711
adrenocortical carcinoma 1427 0.00191108856487192
ductal carcinoma in situ 1745 0.00657047676802341
fibroadenoma 557 0.00715568948458247
oligodendroglioma 2849 0.00753071066336185
urothelial carcinoma 318 0.0121426374563267
lung cancer 4473 0.0213706583704466
gastric carcinoma 832 0.0218971589895671
medulloblastoma, large-cell 6234 0.0221821557886825
astrocytoma 1493 0.0244883035903332
colon cancer 1475 0.0420391384179529
ependymoma 2514 0.044774893891418

Expression

Synonym

Accession Q9UKU9 Q5JT58 Q8NCH7
Symbols ARP2
HARP

Gene

PANTHER Protein Class (1)

  Ortholog (13)

Gene RIF (34)

PMID Text
26435501 Angptl2 induces proinflammatory responses in peritoneal macrophages and monocytes.
26420253 Serum ANGPTL2 in GC patients was significantly higher than for healthy controls.
26254352 ANGPTL2 may be a useful marker for detecting early postoperative recurrence in patients with gastric cancer.
26132105 ANGPTL2 promotes adipose tissue macrophage and T lymphocyte accumulation and leads to insulin resistance.
26056041 signaling involving ANGPTL2 and LILRB2 is important for lung cancer development
25999029 these findings are the first to suggest a considerable role for Angptl2 in the pathogenesis of unstable coronary disease in a clinical context
25964566 Serum ANGPTL2 improves preoperative detection of LN metastasis in CRC
25889082 Serum ANGPTL2 concentration was associated with carotid atherosclerosis in patients with type 2 diabetes.
25735609 In lumbar spinal stenosis, Angptl2 promotes inflammation in ligamentum flavum(LF) tissue by activating IL-6 expression, leading to LF degeneration and hypertrophy.
25484242 These results suggested that ANGPTL2 was a potential biomarker for gastric cancer.
More...

AA Sequence

MRPLCVTCWWLGLLAAMGAVAGQEDGFEGTEEGSPREFIYLNRYKRAGESQDKCTYTFIVPQQRVTGAIC      1 - 70
VNSKEPEVLLENRVHKQELELLNNELLKQKRQIETLQQLVEVDGGIVSEVKLLRKESRNMNSRVTQLYMQ     71 - 140
LLHEIIRKRDNALELSQLENRILNQTADMLQLASKYKDLEHKYQHLATLAHNQSEIIAQLEEHCQRVPSA    141 - 210
RPVPQPPPAAPPRVYQPPTYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQ    211 - 280
ALEDGHDTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLG    281 - 350
LENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLD    351 - 420
RDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKKVVMMIRPNPN    421 - 490
TFH                                                                       491 - 493
//

Text Mined References (48)

PMID Year Title
26435501 2015 Angiopoietin-like protein 2 induces proinflammatory responses in peritoneal cells.
26420253 2015 Serum angiopoietin-like protein 2 as a potential biomarker for diagnosis, early recurrence and prognosis in gastric cancer patients.
26254352 2015 Angiopoietin-like Protein 2 as a Predictor of Early Recurrence in Patients After Curative Surgery for Gastric Cancer.
26132105 2015 Angiopoietin Like Protein 2 (ANGPTL2) Promotes Adipose Tissue Macrophage and T lymphocyte Accumulation and Leads to Insulin Resistance.
26056041 2015 ANGPTL2/LILRB2 signaling promotes the propagation of lung cancer cells.
25999029 2015 Elevated Serum Angiopoietin-like Protein 2 in Patients with Acute Coronary Syndrome.
25964566 2015 Serum Angiopoietin-like Protein 2 Improves Preoperative Detection of Lymph Node Metastasis in Colorectal Cancer.
25889082 2015 Association of serum angiopoietin-like protein 2 with carotid intima-media thickness in subjects with type 2 diabetes.
25735609 2015 Angiopoietin-like protein 2 promotes inflammatory conditions in the ligamentum flavum in the pathogenesis of lumbar spinal canal stenosis by activating interleukin-6 expression.
25484242 2015 Angiopoietin-like protein 2 is a potential biomarker for gastric cancer.
More...