Property Summary

NCBI Gene PubMed Count 61
PubMed Score 58.95
PubTator Score 53.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ductal carcinoma in situ 1.400 2.8e-02
gastric cancer 1.400 1.2e-03
interstitial cystitis 1.500 1.7e-03
invasive ductal carcinoma 1.100 1.9e-02
lung cancer -1.800 1.7e-04
lung carcinoma -1.400 2.5e-13
osteosarcoma -1.925 1.4e-04
primary Sjogren syndrome 1.300 2.5e-03
psoriasis 1.600 4.9e-62
ulcerative colitis 1.300 2.6e-03

Protein-protein Interaction (4)

Gene RIF (36)

AA Sequence

MEDIQTNAELKSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKVKDEYSERDEN      1 - 70
VLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSFDSSRPTSGKMNCDVCGLSCISFNVLMVHKRSH     71 - 140
TGERPFQCNQCGASFTQKGNLLRHIKLHTGEKPFKCHLCNYACQRRDALTGHLRTHSVEKPYKCEFCGRS    141 - 210
YKQRSSLEEHKERCRTFLQSTDPGDTASAEARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRH    211 - 280
CFDVNYNSSYMYEKESELIQTRMMDQAINNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAE    281 - 350
MSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQNHIYQQNHMVLSRARNGMPLLKE    351 - 420
VPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGYRSH    421 - 490
DRYEFSSHIARGEHRALLK                                                       491 - 509
//

Text Mined References (68)

PMID Year Title