Property Summary

NCBI Gene PubMed Count 54
Grant Count 39
R01 Count 29
Funding $3,409,892.56
PubMed Score 54.98
PubTator Score 53.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.400 0.001
osteosarcoma -1.925 0.000
lung cancer -1.800 0.000
interstitial cystitis 2.100 0.003
primary Sjogren syndrome 1.300 0.003
lung carcinoma -1.400 0.000
ductal carcinoma in situ 1.400 0.028
invasive ductal carcinoma 1.800 0.023
ulcerative colitis 1.300 0.003
psoriasis 1.600 0.000

Gene RIF (31)

PMID Text
27080863 Our data indicate a possible regulatory role for the multiple sclerosis-associated IKZF3 and IQGAP1 variants.
26546109 results indicate that overexpression of Aiolos may contribute to pathogenesis of SLE and RA
26185311 identified a unique case of adult acute B-cell lymphoblastic leukemia with masked low hypodiploidy (mLH) by genomic duplication
25620289 The allele T of rs10852936 surrounding the IKZF3-ZPBP2 locus confers risk for early-onset psoriasis.
25608224 Aiolos improved the survival of Nalm6 cells via PTEN and Aktdependent processes.
25524659 lentivirus-mediated AIOLOS overexpression in Jurkat cells induced cell apoptosis, arrested the cell cycle at the G0/G1 phase, and synergistically increased the sensitivity of Jurkat cells to etoposide by inhibiting NF-kappaB activity.
25446972 The immunosuppressive enzyme IL4I1 expressed differentially in human induced Aiolos+, but not natural Helios+, FOXP3+ Treg cells.
25271777 A strong association between rs907091 in the IKZF3 gene and SLE was identified.
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that IKZF3 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with IKZF3
25011556 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that IKZF3 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with IKZF3
More...

AA Sequence

MEDIQTNAELKSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKVKDEYSERDEN      1 - 70
VLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSFDSSRPTSGKMNCDVCGLSCISFNVLMVHKRSH     71 - 140
TGERPFQCNQCGASFTQKGNLLRHIKLHTGEKPFKCHLCNYACQRRDALTGHLRTHSVEKPYKCEFCGRS    141 - 210
YKQRSSLEEHKERCRTFLQSTDPGDTASAEARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRH    211 - 280
CFDVNYNSSYMYEKESELIQTRMMDQAINNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAE    281 - 350
MSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQNHIYQQNHMVLSRARNGMPLLKE    351 - 420
VPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGYRSH    421 - 490
DRYEFSSHIARGEHRALLK                                                       491 - 509
//

Text Mined References (60)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27080863 2016 Allelic imbalance of multiple sclerosis susceptibility genes IKZF3 and IQGAP1 in human peripheral blood.
26546109 2016 Overexpression of Aiolos in Peripheral Blood Mononuclear Cell Subsets from Patients with Systemic Lupus Erythematosus and Rheumatoid Arthritis.
26185311 2015 Adult Low-Hypodiploid Acute B-Lymphoblastic Leukemia With IKZF3 Deletion and TP53 Mutation: Comparison With Pediatric Patients.
25620289 2015 The allele T of rs10852936 confers risk for early-onset psoriasis.
25608224 2015 Overexpression of Aiolos in Nalm-6 acute lymphoblastic leukaemia cells reduces apoptosis by suppressing phosphatase and tensin homologue deleted on chromosome 10 and activating the phosphatidylinositol-3-kinase/Akt signalling pathway.
25524659 2015 Upregulation of AIOLOS induces apoptosis and enhances etoposide chemosensitivity in Jurkat leukemia cells.
25446972 2015 Differential expression of the immunosuppressive enzyme IL4I1 in human induced Aiolos+, but not natural Helios+, FOXP3+ Treg cells.
25416956 2014 A proteome-scale map of the human interactome network.
25271777 2014 Association between polymorphisms of the IKZF3 gene and systemic lupus erythematosus in a Chinese Han population.
More...