Property Summary

NCBI Gene PubMed Count 20
PubMed Score 16.71
PubTator Score 5.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 4.9e-04
esophageal adenocarcinoma -1.100 2.5e-02
lung cancer -1.400 2.4e-03
osteosarcoma -1.041 5.2e-03
ovarian cancer 1.800 4.5e-05
pancreatic ductal adenocarcinoma liver m... -1.029 7.2e-03
pituitary cancer 1.100 4.3e-06
posterior fossa group B ependymoma 1.100 1.3e-07
sarcoidosis -1.200 1.4e-02

Gene RIF (1)

AA Sequence

MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLSSVIRCLCAID      1 - 70
IHNKTLYHITLWTFLLALGHFLSELFVYGTAAPTIGVLAPLMVASFSILGMLVGLRYLEVEPVSRQKKRN     71 - 140
//

Text Mined References (22)

PMID Year Title