Property Summary

NCBI Gene PubMed Count 20
PubMed Score 12.61
PubTator Score 5.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
esophageal adenocarcinoma -1.100 0.025
osteosarcoma 1.523 0.002
atypical teratoid / rhabdoid tumor 1.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.417 0.005
lung cancer -1.400 0.002
sarcoidosis -1.200 0.014
posterior fossa group B ependymoma 1.100 0.000
ovarian cancer 1.800 0.000
pituitary cancer 1.100 0.000

Synonym

Accession Q9UKR5 Q9P093 Q9UPI2
Symbols ERG28
NET51

Gene

 GO Function (1)

Gene RIF (1)

PMID Text
21934552 Data indicate that integrin beta6, CD46, tissue factor, and chromosome 14 open reading frame 1 (C14ORF1), were identified as overexpressed on pancreatic cancer cell lines.

AA Sequence

MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLSSVIRCLCAID      1 - 70
IHNKTLYHITLWTFLLALGHFLSELFVYGTAAPTIGVLAPLMVASFSILGMLVGLRYLEVEPVSRQKKRN     71 - 140
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24326590 2013 Arabidopsis ERG28 tethers the sterol C4-demethylation complex to prevent accumulation of a biosynthetic intermediate that interferes with polar auxin transport.
23142642 2013 Identifying protein partners of CLN8, an ER-resident protein involved in neuronal ceroid lipofuscinosis.
21934552 2012 RNA interference characterization of proteins discovered by proteomic analysis of pancreatic cancer reveals function in cell growth and survival.
21269460 2011 Initial characterization of the human central proteome.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...