Property Summary

NCBI Gene PubMed Count 38
PubMed Score 104.78
PubTator Score 15.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
ovarian cancer 8492 1.05531215505174E-6
Disease Target Count Z-score Confidence
Intellectual disability 573 3.003 1.5
Disease Target Count Z-score Confidence
Congenital disorder of glycosylation 53 5.109 2.6
Syringomyelia 9 3.298 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.700 0.000

Synonym

Accession Q9UKM7 Q5VSG3 Q9BRS9 Q9Y5K7
Symbols MRT15
ERMAN1
ERManI
MANA-ER

Gene

PANTHER Protein Class (1)

PDB

1FMI   1FO2   1FO3   1X9D  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (38)

PMID Text
26205822 Data show that HIV-1 env protein interacts with alpha-mannosidases ERManI (MAN1B1) and initiates endoplasmic reticulum (ER)-associated protein degradation (ERAD) pathway degradation process.
26205822 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
25411339 Results suggest that endoplasmic reticulum mannosidase I (ERManI) is turned over by an active autophagic process.
24566669 MAN1B1 deficiency appeared to be a frequent cause in our cohort of patients with unsolved congenital disorder of glycosylation type II.
24519966 The properties of ERMAN1 enable rapid selection of endoplasmic reticulum-associated degradation substrates in the endoplasmic reticulum.ERMAN1 digests mono-, di- and tri-glucosylated N-glycans.
24348268 we linked mutations in MAN1B1 to a Golgi glycosylation disorder. Additionally, our results support the recent findings on MAN1B1 localization
23940818 A novel post-transcriptional regulatory mechanism for ERManI via miR-125b and this molecule contributes to the regulation of carcinogenesis in hepatocellular carcinoma.
23427261 ERManI and gamma-COP contribute to a golgi-based quality control module that facilitates the retrieval of captured ERAD substrates back to the endoplasmic reticulum.
21763484 A homozygous nonsense mutation in MAN1B1 segregated with nonsyndromic autosomal-recessive intellectual disability and additional dysmorphic features.
21697506 Golgi localization of ERManI defines spatial separation of the mammalian glycoprotein quality control system
More...

AA Sequence

MAACEGRRSGALGSSQSDFLTPPVGGAPWAVATTVVMYPPPPPPPHRDFISVTLSFGENYDNSKSWRRRS      1 - 70
CWRKWKQLSRLQRNMILFLLAFLLFCGLLFYINLADHWKALAFRLEEEQKMRPEIAGLKPANPPVLPAPQ     71 - 140
KADTDPENLPEISSQKTQRHIQRGPPHLQIRPPSQDLKDGTQEEATKRQEAPVDPRPEGDPQRTVISWRG    141 - 210
AVIEPEQGTELPSRRAEVPTKPPLPPARTQGTPVHLNYRQKGVIDVFLHAWKGYRKFAWGHDELKPVSRS    211 - 280
FSEWFGLGLTLIDALDTMWILGLRKEFEEARKWVSKKLHFEKDVDVNLFESTIRILGGLLSAYHLSGDSL    281 - 350
FLRKAEDFGNRLMPAFRTPSKIPYSDVNIGTGVAHPPRWTSDSTVAEVTSIQLEFRELSRLTGDKKFQEA    351 - 420
VEKVTQHIHGLSGKKDGLVPMFINTHSGLFTHLGVFTLGARADSYYEYLLKQWIQGGKQETQLLEDYVEA    421 - 490
IEGVRTHLLRHSEPSKLTFVGELAHGRFSAKMDHLVCFLPGTLALGVYHGLPASHMELAQELMETCYQMN    491 - 560
RQMETGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPETVESLFYLYRVTGDRKYQDWGWEILQSFSRF    561 - 630
TRVPSGGYSSINNVQDPQKPEPRDKMESFFLGETLKYLFLLFSDDPNLLSLDAYVFNTEAHPLPIWTPA     631 - 699
//

Text Mined References (38)

PMID Year Title
26205822 2015 ERManI (Endoplasmic Reticulum Class I ?-Mannosidase) Is Required for HIV-1 Envelope Glycoprotein Degradation via Endoplasmic Reticulum-associated Protein Degradation Pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25411339 2015 Mammalian ER mannosidase I resides in quality control vesicles, where it encounters its glycoprotein substrates.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24566669 2014 Diagnostic serum glycosylation profile in patients with intellectual disability as a result of MAN1B1 deficiency.
24519966 2014 Trimming of glucosylated N-glycans by human ER ?1,2-mannosidase I.
24348268 2013 MAN1B1 deficiency: an unexpected CDG-II.
23940818 2013 ERManI is a target of miR-125b and promotes transformation phenotypes in hepatocellular carcinoma (HCC).
23427261 2013 Golgi-situated endoplasmic reticulum ?-1, 2-mannosidase contributes to the retrieval of ERAD substrates through a direct interaction with ?-COP.
22160784 2012 In vitro mannose trimming property of human ER ?-1,2 mannosidase I.
More...