Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.74
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
oligodendroglioma -1.200 0.041
osteosarcoma 2.678 0.000
non diabetic and post-ischemic heart fai... -1.200 0.008
non-small cell lung cancer 1.141 0.000
intraductal papillary-mucinous neoplasm ... -1.200 0.013
lung cancer 1.700 0.001
colon cancer 1.600 0.000
group 3 medulloblastoma 1.200 0.038
ovarian cancer 1.500 0.000

Synonym

Accession Q9UKD2 B3KNB3 Q5TG55 Q96SS6 Q9BPV9
Symbols MRT4
C1orf33
dJ657E11.4

Gene

Gene RIF (3)

PMID Text
26494001 Human Mrt4 undergoes phosphorylation in vivo and serines S229, S233, and S235 are phosphorylated by CK2 kinase in vitro.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20083226 characterization of Mrt4; findings show Mrt4 is a trans-acting factor involved in ribosome maturation, with nucleus-cytoplasm shuttling capacity

AA Sequence

MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKN      1 - 70
KVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPG     71 - 140
PLEQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDS    141 - 210
QSGRFQQMGDDLPESASESTEESDSEDDD                                             211 - 239
//

Text Mined References (16)

PMID Year Title
26494001 2015 Molecular behavior of human Mrt4 protein, MRTO4, in stress conditions is regulated by its C-terminal region.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20083226 2010 Subcellular localization of ribosomal P0-like protein MRT4 is determined by its N-terminal domain.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...