Property Summary

NCBI Gene PubMed Count 23
PubMed Score 8.63
PubTator Score 15.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.400 2.7e-03
astrocytic glioma -1.200 6.7e-03
glioblastoma -1.400 7.7e-07
intraductal papillary-mucinous adenoma (... -1.100 1.8e-03
lung carcinoma 1.600 5.2e-19
malignant mesothelioma -1.100 2.7e-06
medulloblastoma -1.100 7.0e-04
oligodendroglioma -1.400 2.4e-02
Pick disease -1.400 3.5e-04

Gene RIF (8)

AA Sequence

MVFSNNDEGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNFQTDVEGRVVE      1 - 70
NISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSC     71 - 140
VSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHEL    141 - 210
VSLNLQSCSRITDEGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTL    211 - 280
LARNCHELEKMDLEECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDN    281 - 350
CLLITDVALEHLENCRGLERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPTAVAGSGQRLCRCC    351 - 420
VIL                                                                       421 - 423
//

Text Mined References (26)

PMID Year Title