Property Summary

NCBI Gene PubMed Count 21
PubMed Score 7.93
PubTator Score 15.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 5.20587243667581E-19
malignant mesothelioma 3163 2.69950244679149E-6
pediatric high grade glioma 2712 3.53686663826181E-5
Pick disease 1893 3.45213268119911E-4
medulloblastoma 1524 7.04411592196532E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00182936931647525
glioblastoma 5572 0.00223020894756397
astrocytic glioma 2241 0.00670460435803652
oligodendroglioma 2849 0.0235045435554544
Disease Target Count Z-score Confidence
Viral pneumonia 5 3.434 1.7

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
astrocytic glioma -1.200 0.007
oligodendroglioma -1.400 0.024
glioblastoma -1.500 0.002
medulloblastoma -1.100 0.001
intraductal papillary-mucinous adenoma (... -1.100 0.002
pediatric high grade glioma -1.400 0.000
lung carcinoma 1.600 0.000
Pick disease -1.400 0.000

Synonym

Accession Q9UKC9 B4DQV0 E9PD06 Q6IAN3 Q9NVQ8 Q9UK27 Q9UKA5 Q9Y3Y9
Symbols FBL2
FBL3

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
C. elegans OMA Inparanoid

Pathway (1)

Gene RIF (7)

PMID Text
26790640 these results uncover a previous unknown network involving FBXL2 and FoxM1 in the regulation of gastric cancer growth.
26037928 FBXL2 recognizes Trp-73 within NALP3 for interaction and targets Lys-689 within NALP3 for ubiquitin ligation and degradation.
23604317 FBXL2 mediates the ubiquitylation and degradation of p85beta on cell membranes.
22455980 These results suggested that the involvement of the reduction of FBL2 level is related to AD progression.
22399757 FBL2 is a novel and dual regulator of amyloid precursor protein (APP) metabolism through FBL2-dependent ubiquitination of APP.
22323446 FBXL2 targets cyclin D2 for ubiquitination and degradation to inhibit leukemic cell proliferation.
22020328 FBXL2 is indispensible regulator of mitosis that serves as a tumor suppressor

AA Sequence

MVFSNNDEGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNFQTDVEGRVVE      1 - 70
NISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSC     71 - 140
VSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHEL    141 - 210
VSLNLQSCSRITDEGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTL    211 - 280
LARNCHELEKMDLEECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDN    281 - 350
CLLITDVALEHLENCRGLERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPTAVAGSGQRLCRCC    351 - 420
VIL                                                                       421 - 423
//

Text Mined References (24)

PMID Year Title
26790640 2016 F-box protein FBXL2 inhibits gastric cancer proliferation by ubiquitin-mediated degradation of forkhead box M1.
26037928 2015 Lipopolysaccharide Primes the NALP3 Inflammasome by Inhibiting Its Ubiquitination and Degradation Mediated by the SCFFBXL2 E3 Ligase.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
23604317 2013 FBXL2- and PTPL1-mediated degradation of p110-free p85? regulatory subunit controls the PI(3)K signalling cascade.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22455980 2013 Neuronal expression of F-box and leucine-rich-repeat protein 2 decreases over Braak stages in the brains of Alzheimer's disease patients.
22399757 2012 FBL2 regulates amyloid precursor protein (APP) metabolism by promoting ubiquitination-dependent APP degradation and inhibition of APP endocytosis.
22323446 2012 F-box protein FBXL2 targets cyclin D2 for ubiquitination and degradation to inhibit leukemic cell proliferation.
22020328 2012 F-box protein FBXL2 exerts human lung tumor suppressor-like activity by ubiquitin-mediated degradation of cyclin D3 resulting in cell cycle arrest.
19159283 2009 Array MAPPIT: high-throughput interactome analysis in mammalian cells.
More...