Property Summary

NCBI Gene PubMed Count 33
PubMed Score 113.29
PubTator Score 29.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
colon cancer -1.300 4.0e-04
cystic fibrosis -1.348 2.2e-04
dermatomyositis 1.200 1.9e-03
group 3 medulloblastoma 2.200 6.8e-03
lung cancer 1.700 7.6e-05
medulloblastoma, large-cell 2.000 4.4e-05
nasopharyngeal carcinoma 1.200 8.0e-04
osteosarcoma 3.353 2.1e-04
Pick disease -1.900 1.3e-05
primitive neuroectodermal tumor 1.100 6.1e-03
psoriasis -1.200 3.1e-06
subependymal giant cell astrocytoma -1.821 4.5e-02
tuberculosis and treatment for 6 months 1.300 5.3e-03

Gene RIF (13)

AA Sequence

MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEV      1 - 70
TETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDN     71 - 140
TLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMYYPVTLDVLHQIFSKFGAVLKI    141 - 210
ITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYTRPDLPSG    211 - 280
DGQPALDPAIAAAFAKETSLLAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAGGNTVLLVSNLNEEMV    281 - 350
TPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTVQLPRE    351 - 420
GLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQD    421 - 490
HKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI                                 491 - 531
//

Text Mined References (38)

PMID Year Title