Property Summary

NCBI Gene PubMed Count 32
Grant Count 29
R01 Count 24
Funding $3,185,322.95
PubMed Score 105.99
PubTator Score 29.27

Knowledge Summary


No data available


  Differential Expression (13)

Disease log2 FC p
psoriasis -1.200 0.000
osteosarcoma 3.353 0.000
group 4 medulloblastoma 3.600 0.000
cystic fibrosis -1.348 0.000
medulloblastoma, large-cell 2.000 0.000
primitive neuroectodermal tumor 1.100 0.006
tuberculosis and treatment for 6 months 1.300 0.005
colon cancer -1.300 0.000
lung cancer 1.700 0.000
subependymal giant cell astrocytoma -1.821 0.045
nasopharyngeal carcinoma 1.200 0.001
Pick disease -1.900 0.000
dermatomyositis 1.200 0.002

Gene RIF (12)

26657638 Data show that polypyrimidine tract-binding proteins nPTB and ROD1 interact with mitochondrial tRNA(Thr) in the cytoplasm outside of mitochondria.
26416554 PTBP1 and PTBP2 impaired autoregulation of SRSF3 in oral squamous cell carcinoma cancer cells.
25025966 MALAT1 binds to SFPQ releasing PTBP2 from the SFPQ/PTBP2 complex, the increased SFPQ-detached PTBP2 promotes cell proliferation and migration in colorectal cancer.
24286314 In T98G glioma cells, the level of sumoylated PTBP2 was reduced compared to that of normal brain cells. Overall, this study shows that PTBP2 is posttranslationally modified by SUMO1.
24264039 Defining the multifunctional roles of PTB will contribute to the understanding of key regulatory events in gene expression.
23174904 Changes in miR-223/PTBP2 pathway could contribute of abnormal splicing in chronic myeloid leukemia.
21282112 Regulation of the mutually exclusive exons 8a and 8 in the CaV1.2 calcium channel transcript by polypyrimidine tract-binding protein.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20160105 present fluorescence, NMR, and in vivo splicing data in support of a role of PTB in inducing RNA loops. We show that the RNA recognition motifs (RRMs) 3 and 4 of PTB can bind two distant pyrimidine tracts and bring their 5' and 3' ends in close proximity
17548433 Study shows that PTB can function as an anti-repressor molecule to counteract the splicing inhibitory activity of SRp30c.

AA Sequence

HKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI                                 491 - 531

Publication (37)

PMID Year Title
26657638 2016 Human polypyrimidine tract-binding protein interacts with mitochondrial tRNA(Thr) in the cytosol.
26416554 2015 PTBP1 and PTBP2 impaired autoregulation of SRSF3 in cancer cells.
25025966 2014 Long non-coding RNA MALAT1 promotes tumour growth and metastasis in colorectal cancer through binding to SFPQ and releasing oncogene PTBP2 from SFPQ/PTBP2 complex.
24688880 2014 Solution and crystal structures of a C-terminal fragment of the neuronal isoform of the polypyrimidine tract binding protein (nPTB).
24448406 2014 The splicing regulator PTBP2 controls a program of embryonic splicing required for neuronal maturation.
24286314 2014 Characterization of a novel posttranslational modification in polypyrimidine tract-binding proteins by SUMO1.
24264039 2013 New insights into functional roles of the polypyrimidine tract-binding protein.
23174904 2013 BCR-ABL mediated repression of miR-223 results in the activation of MEF2C and PTBP2 in chronic myeloid leukemia.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.