Property Summary

NCBI Gene PubMed Count 15
PubMed Score 148.38
PubTator Score 29.84

Knowledge Summary


No data available


  Disease (3)

Disease Target Count P-value
psoriasis 6694 3.3e-06
osteosarcoma 7950 6.8e-05
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 3.0
Disease Target Count Z-score Confidence
Rectum cancer 12 5.687 2.8


  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.245 6.8e-05
psoriasis -1.100 3.3e-06


Accession Q9UK85
Symbols SGY


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

DVLEEGTESSSHSRLSPRKTHLLYILRPSRQL                                          211 - 242

Text Mined References (15)

PMID Year Title