Property Summary

NCBI Gene PubMed Count 13
Grant Count 4
Funding $470,532.56
PubMed Score 134.00
PubTator Score 29.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.245 0.000
psoriasis -1.100 0.000

Gene RIF (3)

PMID Text
24909558 Findings suggest that Dkk-3 plays a role in the regulation of cell interactions during retinoic acid-induced neuronal differentiation; effect on apoptosis was also observed upon expression of the related protein Dkkl-1
24190897 Unliganded VDR upregulates the expression of hairless, the gene product of which acts as a downstream comodulator to feedback-repress DKKL1 and SOSTDC1.
22817830 DKKL1/Dkkl1 may play an important role in testicular development and spermatogenesis and may be an important factor in male infertility.

AA Sequence

MGEASPPAPARRHLLVLLLLLSTLVIPSAAAPIHDADAQESSLGLTGLQSLLQGFSRLFLKGNLLRGIDS      1 - 70
LFSAPMDFRGLPGNYHKEENQEHQLGNNTLSSHLQIDKMTDNKTGEVLISENVVASIQPAEGSFEGDLKV     71 - 140
PRMEEKEALVPIQKATDSFHTELHPRVAFWIIKLPRRRSHQDALEGGHWLSEKRHRLQAIRDGLRKGTHK    141 - 210
DVLEEGTESSSHSRLSPRKTHLLYILRPSRQL                                          211 - 242
//

Publication (13)

PMID Year Title
24909558 2014 Dickkopf-3 alters the morphological response to retinoic acid during neuronal differentiation of human embryonal carcinoma cells.
24190897 2014 Vitamin D receptor-mediated control of Soggy, Wise, and Hairless gene expression in keratinocytes.
22817830 2012 Developmental expression and function of DKKL1/Dkkl1 in humans and mice.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15892050 2005 DkkL1 (Soggy), a Dickkopf family member, localizes to the acrosome during mammalian spermatogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...