Property Summary

NCBI Gene PubMed Count 4
PubMed Score 12.18
PubTator Score 8.20

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.000 9.5e-05
atypical teratoid / rhabdoid tumor -2.400 2.8e-08
ependymoma -1.400 5.3e-08
glioblastoma -1.600 2.2e-06
group 3 medulloblastoma -2.300 1.8e-04
juvenile dermatomyositis -1.059 5.0e-11
lung carcinoma 1.400 7.8e-34
medulloblastoma, large-cell -2.700 4.7e-07
primitive neuroectodermal tumor -1.400 4.6e-04
subependymal giant cell astrocytoma -1.366 3.3e-02

Synonym

Accession Q9UK28
Symbols BSMAP
C19orf4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAAVALMPPPLLLLLLLASPPAASAPSARDPFAPQLGDTQNCQLRCRDRDLGPQPSQAGLEGASESPYDR      1 - 70
AVLISACERGCRLFSICRFVARSSKPNATQTECEAACVEAYVKEAEQQACSHGCWSQPAEPEPEQKRKVL     71 - 140
EAPSGALSLLDLFSTLCNDLVNSAQGFVSSTWTYYLQTDNGKVVVFQTQPIVESLGFQGGRLQRVEVTWR    141 - 210
GSHPEALEVHVDPVGPLDKVRKAKIRVKTSSKAKVESEEPQDNDFLSCMSRRSGLPRWILACCLFLSVLV    211 - 280
MLWLSCSTLVTAPGQHLKFQPLTLEQHKGFMMEPDWPLYPPPSHACEDSLPPYKLKLDLTKL            281 - 342
//

Text Mined References (5)

PMID Year Title