Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.68
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Synonym

Accession Q9UJQ7 Q548A4
Symbols HSD22
C20orf79
dJ1068E13.2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 HCA RNA Cell Line (2)

AA Sequence

MWKRSDHQPKIKAEDGPLVGQFEVLGSVPEPAMPHPLELSEFESFPVFQDIRLHIREVGAQLVKKVNAVF      1 - 70
QLDITKNGKTILRWTIDLKNGSGDMYPGPARLPADTVFTIPESVFMELVLGKMNPQKAFLAGKFKVSGKV     71 - 140
LLSWKLERVFKDWAKF                                                          141 - 156
//

Text Mined References (4)

PMID Year Title