Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.28
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q9UJQ7 Q548A4
Symbols HSD22
C20orf79
dJ1068E13.2

Gene

AA Sequence

MWKRSDHQPKIKAEDGPLVGQFEVLGSVPEPAMPHPLELSEFESFPVFQDIRLHIREVGAQLVKKVNAVF      1 - 70
QLDITKNGKTILRWTIDLKNGSGDMYPGPARLPADTVFTIPESVFMELVLGKMNPQKAFLAGKFKVSGKV     71 - 140
LLSWKLERVFKDWAKF                                                          141 - 156
//

Publication (4)

PMID Year Title
16501878 2006 Fusion and fission, the evolution of sterol carrier protein-2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.