Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.17
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.100 2.4e-03
ductal carcinoma in situ -1.200 3.4e-04
group 4 medulloblastoma -1.900 1.5e-06
inflammatory breast cancer -1.300 2.8e-03
invasive ductal carcinoma -1.900 2.8e-03

 MGI Phenotype (1)

Gene RIF (3)

AA Sequence

MERPAPLAVLPFSDPAHALSLLRGLSQLRAERKFLDVTLEAAGGRDFPAHRAVLAAASPYFRAMFAGQLR      1 - 70
ESRAERVRLHGVPPDMLQLLLDFSYTGRVAVSGDNAEPLLRAADLLQFPAVKEACGAFLQQQLDLANCLD     71 - 140
MQDFAEAFSCSGLASAAQRFILRHVGELGAEQLERLPLARLLRYLRDDGLCVPKEEAAYQLALRWVRADP    141 - 210
PRRAAHWPQLLEAVRLPFVRRFYLLAHVEAEPLVARCPPCLRLLREARDFQAARYDRHDRGPCPRMRPRP    211 - 280
STGLAEILVLVGGCDQDCDELVTVDCYNPQTGQWRYLAEFPDHLGGGYSIVALGNDIYVTGGSDGSRLYD    281 - 350
CVWRYNSSVNEWAEVAPMLKAREYHSSSVLDGLLYVVAADSTERYDHTTDSWEALQPMTYPMDNCSTTAC    351 - 420
RGRLYAIGSLAGKETMVMQCYDPDTDLWSLVDCGQLPPWSFAPKTATLNGLMYFVRDDSAEVDVYNPTRN    421 - 490
EWDKIPSMNQVHVGGSLAVLGGKLYVSGGYDNTFELSDVVEAYDPETRAWSVVGRLPEPTFWHGSVSIFR    491 - 560
QFMPQTFSGGRGFELDSGSDDMDPGRPRPPRDPDELH                                     561 - 597
//

Text Mined References (11)

PMID Year Title