Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.11
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MESLRGNTAQGPTNEEDYKNEGQLSRQTKCPAQKKSSFENTVVRKVSVTLKEIFTGEEGPESSEFSLSPN      1 - 70
LDAQQKIPKGHGSPISRKNSKDNSDLIKHQRLFSQRKPCKCNECEKAFSYQSDLLVHSRIHGGEKPFECN     71 - 140
KCGKSFSRSTHLIEHQRTHTGEKPYECNECGKAFSRSTHLSLHQRIHTGEKPYECSECGKAFSRSTNLSQ    141 - 210
HQRTHTQERPYKCNECGKAFGDRSTIIQHQRIHTGENPYECSKCGKAFSWISSLTEHQRTHTGENPYECS    211 - 280
ECGKVFSRSSSLTEHQRIHSGEKPHECRVCGKGFSRSSSLIIHQRTHTGEKPYKCNDCGKAFCQSSTLIR    281 - 350
HQHLHTKE                                                                  351 - 358
//

Text Mined References (8)

PMID Year Title
18253864 2008 Keep your fingers off my DNA: protein-protein interactions mediated by C2H2 zinc finger domains.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14577126 2003 Role of zinc in eukaryotic cells, zinc transporters and zinc-containing proteins. Review article.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12664966 2003 Singlet oxygen-induced signaling effects in mammalian cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.